SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000004970 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000004970
Domain Number 1 Region: 591-693
Classification Level Classification E-value
Superfamily Bromodomain 1.44e-30
Family Bromodomain 0.00034
Further Details:      
 
Domain Number 2 Region: 1030-1148
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.99e-19
Family PWWP domain 0.013
Further Details:      
 
Domain Number 3 Region: 231-301
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.42e-17
Family PHD domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000004970
Domain Number - Region: 342-378
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000193
Family PHD domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000004970   Gene: ENSONIG00000003943   Transcript: ENSONIT00000004973
Sequence length 1164
Comment pep:known_by_projection scaffold:Orenil1.0:GL831197.1:486717:495743:1 gene:ENSONIG00000003943 transcript:ENSONIT00000004973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRGRGRGRGRGRGTSGQLRPPSPYRLQLSPSRETLTYAQAQKIVEVDLDGRLHRINITD
TLPVITEDEMMAQDIAECNSNKENSEQTQSKTKTWRKPTNGKNRRSGKNTSNQNQRSSSN
QHTGSAFSFQQPALQTPLPEPTFRVLSSVSPTEAPPLPAAYYRYIEKSGEEQDSVAEYDM
DEEDLAWLEMVNQKRVSDGHASVSPDTFELLIDRLERESILESRSQALSQNAVDEDAFCC
VCLDDECLNSNVILFCDICNLAVHQECYGVPYVPEGQWLCRCCLQSPSRPVDCVLCPNRG
GAFKQTSDGRWAHVVCAIWIPEVCFANTVFLEPVEGVSNIPPARWKLTCYLCKQKGRGAS
IQCHKANCYRAFHVTCAQKAGLFMKIDPVRETSVNGTTFSVKKTAFCEHHSPVGSRRDGS
GDESVEGRLVGGRGNRGQRSYTQSPPSSPNKKATKGQKKKNSKGSGGSRRSNIPVLLVPQ
IPSHRLNKICTGVEVQRKNQFMQRLHNYWLLKRQSRNGMPLIRRLHSHLQAHRTAEQREP
DEKLSAAREELRYWQKLRQDLERARLLVELIRKRERLKREQMKIQQAALELKLTPALVLL
RSTLEQLQEKDTAKIFSQPVNLSEVPDYLEFITQPMDFSTMRTKLEGHAYCSITDLEEDF
DLMISNCLKYNSKDTMFHRAALQLREVGGAVLRHAHRQSQSIGLDPSTGMHLPEAPNKHG
FYNCTWDDVDSLLDPENRLHLTTEEQLKALLDKLDVVTSMRTSGGRTKRIRLLRREINTL
RQKMNQQQSAQSVNGIEKRQRSSRSGSKSQGEDEAEVGETPSSEPDAVHEVTPLGTPPTL
SLVGVGRRTSVLFKKAKNGARMVKNKSLPQQNGKTSEAKSNGLDSTATSPNSPSMNNITT
LPPPNASPAPPSPSSHRLRSRGHSSESEADKLPPPPTEGEKTGGRKSVFVTMWFVVLLGL
TNGKHSSAEHDEDDSNVSTPLCSVSPPKRSRGKPALAKVPSSENGDISGSGVYHEKTKYR
KSTLLSLDSETKLAPLDLVWAKCRGYPSYPAMIVDPDMPQEGLLHNGIPIPVPPLEVLKL
GEWRQTEEDQKLFLVLFFDTKRTWQWLPRNKLLPLGMDDTVDKLRLMEGKKPSVRKSVHT
AYDRAMVHLNHVRGNLNFTPSNFI
Download sequence
Identical sequences I3J7Y0
ENSONIP00000004970 ENSONIP00000004970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]