SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000004990 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000004990
Domain Number 1 Region: 560-665
Classification Level Classification E-value
Superfamily Bromodomain 2.62e-34
Family Bromodomain 0.00028
Further Details:      
 
Domain Number 2 Region: 205-280
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 9.98e-19
Family PHD domain 0.01
Further Details:      
 
Domain Number 3 Region: 1052-1166
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000000126
Family PWWP domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000004990
Domain Number - Region: 323-356
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00175
Family PHD domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000004990   Gene: ENSONIG00000003960   Transcript: ENSONIT00000004993
Sequence length 1183
Comment pep:known_by_projection scaffold:Orenil1.0:GL831206.1:1672948:1684839:-1 gene:ENSONIG00000003960 transcript:ENSONIT00000004993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKKSRNQRPAVIKRETSPIKPSPNRETLTYAQAQRMVELEVDGRVHRLSIYDKLDVITD
DDPTAQEIMECNSNKENNEKPQQVLVRSVRLKNNQQKKNAALTTSHGGSATHSSTSGLLE
PKVRTVEYNLPVVPKRPATYYKYTERTPEELDEEVEYDMDEEDYAWMEIINEKRKSEGIS
QVSHNLFEFLMDRFEKESFLATQGQSDLQSLVDEDAVCCICMDGDGADSNVILFCDSCNI
AVHQECYGVPYIPEGQWLCRHCLQCPTRPAECVFCPNRGGALKKTDDDRWGHVACALWVP
EVGFSDTVFIEPIDGVRNIPPARWKLTCYLCKEKGVGACIQCDKINCYTAFHVSCAQKAG
LCMKMEPVKEVTASGATTFSVKKTAYCCSHTPEGCDRRPLNIYEEPHPKNGAFHKRAEKK
GKAKGWQKKKNKRADPEPETEPETPTSSGPSITASSFDTILNQVSVQRKRSFVEGVLSYW
VLKRQSRNNVPLIRRLQANPQPPKAKQTDHMESNQALKEQLKEWHRLRHDLERARLLLEL
IRKREKLKREEMKLQQSVLEVQLTPFNILLRAVLSQLQEKDQYSIFAQPVSVKEVPDYLD
IIKNPMDFSTMRKRIDAHFYRSLEGFEADFDLIISNCMTYNAKDTFFYKAAQRMQDHGGA
ILRRARREAERIGFDFPSGLHLPEVPKLEPTPPFTWEDVDRLLTPTYRQKTPLEDQLKEL
LEKLDLSIAMKHSPSRSKRLKLLKKTITEVRSEISLKNSLPPQPSTPDPSPSPAESEDQP
LRELLADPSMTQEDKSLPPPPLETLTLPSQILPMDLDPTPVKLTKPLDQTPAELEDVTNT
STSVPSDTPNGHIPESLLPKSDLYVERYNRRTNVLFRKSKSASPQKPPRTQEVSSGSPPP
LGAKTFLSVVIPRLETLLLPKKRKRSSSADGEDDEESPIKRLGTGARMANGFVVEEEGVV
SQSPRLLEPRRRCASESSISSSGSILCDTRTVILSKSGKGRPATARRSTVDDKSTLMTCI
ENGEFIKAAKISSVIVPVEVWKPTAASPFVLEPLKLVWAKCSGYPSFPALIMDPRSRKTM
CRHSGVDLPQPPLDVLRAGERMQFRSAEKLFLVHFFDSRRSWQWLPRSKMAPFGINKMLD
RMKLMEARSSSVRKSVRLAFDRAMKHLDRIRELEPNTGLGVTI
Download sequence
Identical sequences I3J800
ENSONIP00000004990 ENSONIP00000004990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]