SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000005026 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000005026
Domain Number 1 Region: 880-1055
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-46
Family SPRY domain 0.0015
Further Details:      
 
Domain Number 2 Region: 555-853
Classification Level Classification E-value
Superfamily RNI-like 6.17e-28
Family 28-residue LRR 0.00022
Further Details:      
 
Domain Number 3 Region: 117-304
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000278
Family G proteins 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000005026   Gene: ENSONIG00000003991   Transcript: ENSONIT00000005030
Sequence length 1055
Comment pep:novel scaffold:Orenil1.0:GL831393.1:464801:485490:-1 gene:ENSONIG00000003991 transcript:ENSONIT00000005030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSHWDQTASSGDYYCTHCKERSRTRAGLQTASQSCCVQNVGLQEVLDAHKISLRRRCER
VTEGTDETGNTTLLNMIYTELYITEGPSEEVHTQHEVRQLETASKTDALHDTPIRCQDIF
KALPDQQRPIRVVLTNGIAGVGKTFSVLKFTLDWAEGLENQHVNVVILLSFRELNLIRDE
QYSLLELLHVFHPTLQKVTAEKLAVSQLLFIFDGLDESRLSLDFTNRNLVSDVTQKSSVS
ELLTNLIQGNLLPSALIWITSRPVAANQIPPTCANRVTEVRGFTDAQKEEYFRRRFSDEE
LSSRIVSHMKTSRSLHIMCSIPVFCWVTATVLEHMLTTEQRGELPKTLTDMYSHFLLVQA
KRKRNKYHEGHETGPQELMEADREVLLKLGRLAFEHLEKGNIMFYQEDLEQCGLDVTDTL
MYSGVCTEIFKRECVIFQKPVYCFVHLSIQEFLAAVYMFHCYTNRKTELLENHLGKKYKE
SSLDDFLKWVMKKSLQCKNGYLDLFVRFLHGLSLESNQRLLGGLLGQTEHSPEIIQRVIN
NLKEMNSDKISSDGSINIFHCLMEMNDLSLFQEIREFLRSENSSEKKLSEIQCSALAFML
QMSEEVLDELDLHKYNTSKRGRLRLIPAVRNCRKARFHCFATKQLCLRMAFRTSTESCVF
YRGEANQQKNDSLNIALNLLLDSIGFSQNHFCIFSNNRLTGCQLSETHCEVLSSALKSNP
SHLTELDMSNNDLQDLAVRLICAGLESPNCRVETLRLSGCNLSDTSYEVLSSFLSSQSSS
LRELDLNNNNLHESKLKLLFAAVESPHCTLGILRPEIQYSFLYIAPYHKSSHLKVLYIVS
KHFGDSGKEKLSFNRKKPLAETGLGRGGHLLEPVGVREDSCQLTIDTNTVNTNLKLSDNN
RKVTRVKEVQSYPDHPDRFDVHPQLLCKNRLTGRCYWEVEWRRVVWISVSYRRIRRKGES
NDCVFGWNDQSWSLYCSYDGPRSVWHNNRSIAISPSSSSSVSNRAAVYVDCPAGTLSFYR
VSSDTLIHLHTFNTTFTETLYPGFWVFPGSSVSLC
Download sequence
Identical sequences I3J836
ENSONIP00000005026 ENSONIP00000005026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]