SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000005124 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000005124
Domain Number 1 Region: 145-669
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.74e-79
Family RNA helicase 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000005124   Gene: ENSONIG00000004067   Transcript: ENSONIT00000005128
Sequence length 1135
Comment pep:known_by_projection scaffold:Orenil1.0:GL831494.1:340760:353089:-1 gene:ENSONIG00000004067 transcript:ENSONIT00000005128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASEKRSWDWGSSQCRAQLDEIFFREHDYIQAGSSEHKEFWAFFERFQRFKTKRDIKEDK
DKGRDRGKVDLGLPKEYDARYRINVSVCTRDIEERMGKSEHRSRQRSSGPGAQEVSDCRL
ALLHFLDFSQKQSFGKLAKLRREQKNLPIFQYRDRIVELVRLHPVVVVAGDTGCGKSTQV
PQYLLSAGFNNIACTQPRRIACISLAKRVSFESLNQYGSKVGYQIRFETSRTATTKLLFL
TEGLLLRQIQQDSTLARYQVVIVDEVHERHLHCDFLLGVLRSLLADRPDLRLILMSATIN
IKLFSNYFSGAPVLQVPGRLFPIQVIYQPIPPEEQSSKSEKLDPRPYLRILQGIDQRYPP
EERGDLLLFLSGVAEISTIQEACQIYATHTRRWIILTLHSTLSIAQQDKVFDIAPPGVRK
CIISTNIAETSVTIDGVRFVVDSGKVKEMSFDPKAKMQRLQEFWISRASSEQRKGRAGRT
GPGVCYRLYSESDYNAFAPYPVPEIHRVALDSLILQMKSMSLGDPLSFVFIDPPPAASIQ
NAVFYLKEQGALDSRGELTSIGSLLAQLPVDVVIGKMLVLGCLFNLVEPVLTVAAALSVQ
SPFLRSSQHNPDCATARQPLHSNQGDPFTLLNTFNAWVEVKRERGGGSRKWCRRRGLEEQ
RLYEMVNLRRQFKDLLRSHSLLESEDSTPSGGDRVQRRERLTERRKLHQLKRDHEQQEGS
KRKVLKLEEGQEGDFSSGSDTEETGRSKRNKEGSGQNLDIQEVKFKLRHNVSELQEAVSQ
DLSSHQQALLKLLLCRGLYPQLALPDEHNSTRKDSDQVFHTRNKQGVVIHPTSVFASDPE
VLQVPEGDTGEMGPDRRDSTKHQLLAFVTLLETNKPYLSNCVRVPALQALLLVANTVDTN
ADCTRLVVDGWLELELKEPEEALKVLSTALTLRAEWERLLQAQLGQNSTGGAAVGQGVSR
RVVQKLSESLVRFLLYTEVSYSLRRLSAFQTQNLYIGPQLESVLSNTKAGDLNPLFPGAE
AKPDPIKGGLRVTNFFTYNCLADSKDLYSECLRTFWSCPNCDLYMPLTPLERMHHETSCR
PAGEQQQPEEEPEGGKASSSSVSSLTRVYHCDVCNQDLTLTSTEILKHKRQHMYS
Download sequence
Identical sequences I3J8D4
ENSONIP00000005124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]