SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000005167 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000005167
Domain Number 1 Region: 8-203
Classification Level Classification E-value
Superfamily PRTase-like 1.7e-41
Family Phosphoribosyltransferases (PRTases) 0.00085
Further Details:      
 
Domain Number 2 Region: 224-437
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.03e-37
Family Decarboxylase 0.00000818
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000005167   Gene: ENSONIG00000004100   Transcript: ENSONIT00000005171
Sequence length 441
Comment pep:known_by_projection scaffold:Orenil1.0:GL831621.1:233331:238946:-1 gene:ENSONIG00000004100 transcript:ENSONIT00000005171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESMDGASTASLIPKLHDVNGVKFGEYKLKSGLLAPIYIDLRVLVSHPALMNQVVSLIYER
VQEEGLQFHSVCGAPYTALPLATVICSRHELPMIIRRKEAKDYGTKRLVEGSLRQGDTCL
IIEDTVTSGTSILETAEVLCKEGLKVTDAVVLMDREQGGVEMLASKGIKLHPIISISQLL
RVLQAAERIDAQTAQSVHRFIQDNNTFSPKNGSDSPASKKLQLSYSDRAELPNLHPPASK
LLKIMEEKQSNLCVSADVTNSEELLQESLGPKICMLKTHVDILEGYTLAFIQKVQALAEK
HDFLIFEDRKFADIRNTVKHQYEGETISHFLLVVFSLQLFCVAQVQMAEEHSDFVMGFIC
GSKLTERPEFIHMTPGVQMQAGGDLLGQQYTTPEEVVYNKGSDVIIVGRGILAASDRAGA
AELYRKSGWDAYRKRVGQSSI
Download sequence
Identical sequences I3J8H7
ENSONIP00000005167 ENSONIP00000005167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]