SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000005168 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000005168
Domain Number 1 Region: 3-24,143-313
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.89e-58
Family G proteins 0.0000000423
Further Details:      
 
Domain Number 2 Region: 24-145
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 1.83e-42
Family Transducin (alpha subunit), insertion domain 0.00000233
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000005168   Gene: ENSONIG00000004101   Transcript: ENSONIT00000005172
Sequence length 318
Comment pep:known_by_projection scaffold:Orenil1.0:GL831197.1:1229426:1244974:-1 gene:ENSONIG00000004101 transcript:ENSONIT00000005172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTGAGESGKSTIVKQMKIIHEDGYSEDECKQYRAVVYSNTIQSIMAIVKAMASLKIDYSN
PARVDDAQQLFALAAAAEEQGILPDDLANVIRRLWSDSGIQSCFARSREYQLNDSAAYYL
NDLERIAKTDYIPTQQDVLRTRVKTTGIVETHFTFKELHFKMFDVGGQRSERKKWIHCFE
GVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEE
KITRSPLTICFPEYAGANKFDEAASYIQTKFEDLNKKKDTKEIYTHFTCATDTKNVQFVF
DAVTDVIIKNNLKDCGLF
Download sequence
Identical sequences I3J8H8
ENSONIP00000005168 ENSONIP00000005168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]