SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000005223 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000005223
Domain Number 1 Region: 10-211
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.47e-28
Family G proteins 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000005223   Gene: ENSONIG00000004146   Transcript: ENSONIT00000005227
Sequence length 313
Comment pep:novel scaffold:Orenil1.0:GL831389.1:348254:350997:1 gene:ENSONIG00000004146 transcript:ENSONIT00000005227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSTYALLDDEEEEEPEFRIILVGKTGVGKSAAGNTILGTRTFISTTSPSTVTLECQKER
GEFGGHALAVIDTPGLFDTSKTEKEVKREIARSISFVAPGPHVFLVVLQAGRFTKEEQET
VKILQKVFGETAAQYTMALFTHGDNLEADDVTIETFIHKSKALNDFLDQCQGRYHVFNNR
KEDPAQVRELLEKINTMVQRNGGSCYTNEKFLEAERVIREEMDRLLRENPGMTPQEARRL
AEKDNWFIQAIVAAAGAIPGIGLGAGVGLAVEVAIGAGVGAVGGPIGAAVGAVVGAVAGA
TVVAVKSGACPIQ
Download sequence
Identical sequences I3J8N3
XP_003457733.1.78416 ENSONIP00000005223 ENSONIP00000005223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]