SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000005237 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000005237
Domain Number 1 Region: 507-628
Classification Level Classification E-value
Superfamily Bromodomain 1.31e-31
Family Bromodomain 0.00047
Further Details:      
 
Domain Number 2 Region: 178-290
Classification Level Classification E-value
Superfamily Bromodomain 1.96e-31
Family Bromodomain 0.00066
Further Details:      
 
Domain Number 3 Region: 634-759
Classification Level Classification E-value
Superfamily Bromodomain 2.22e-30
Family Bromodomain 0.0011
Further Details:      
 
Domain Number 4 Region: 385-492
Classification Level Classification E-value
Superfamily Bromodomain 2.35e-30
Family Bromodomain 0.00054
Further Details:      
 
Domain Number 5 Region: 24-156
Classification Level Classification E-value
Superfamily Bromodomain 5.49e-29
Family Bromodomain 0.0012
Further Details:      
 
Domain Number 6 Region: 1348-1431
Classification Level Classification E-value
Superfamily HMG-box 9.95e-18
Family HMG-box 0.00092
Further Details:      
 
Domain Number 7 Region: 812-880
Classification Level Classification E-value
Superfamily Bromodomain 0.000000209
Family Bromodomain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000005237   Gene: ENSONIG00000004158   Transcript: ENSONIT00000005241
Sequence length 1669
Comment pep:known_by_projection scaffold:Orenil1.0:GL831197.1:1573173:1587715:-1 gene:ENSONIG00000004158 transcript:ENSONIT00000005241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASSKRRRATSPSSSVSGGGDLDDVSSSTPGSGRKRKRVSNVPPVDTIAVCHELFNTVRDY
KDDQGRQLSEVFQRVPKRRNQPDYYEVVSQPIDMTKIQYKLKSEDYNDVEQLTADFQLLF
NNARSFYKRDSEEYQAACKLWEVYFQTRNEFVQPGDGDEDDDDGDDMDNAGMATEEETSV
GSLKEVLEQLLEAIVSHADPSGRLVSELFQKLPSKVHYPDYYAIIKEPIDLRTIAQRIQI
GYYKNVNAMAKDVELMTKNAKTYNEPGSQVFKDANTIKKVFIQRKTELEHAEPTKSSLRI
SKSNLLVIPTEKSHTFKIYMVNCVSLLLFRNRRSGQGDRISGVSVALQYGSESEDDPVLS
GSVCYDEGESEAESQSSSMEMSNPIFQLYEAVRGARNNQGQMFSEPFQQLPSRREYPDYY
QQIKQPISLQQIRAKMKNGEYDSVEQIETDLNLMFENAKRYNMPNSSIYKRAFRLQQIMQ
AKKRELLRRDDEDGDSILSSDAGSVKRKSHKKNVKKNRMKAFYAAVTEAREAGTNRRLCD
LFMVKPSKKDYPDYYNVILEPMDLKTIEHNIRNERYATEEALMEDMKLMFRNARHYNEEG
SQVYNDADILEKILKDKRKELGPPPEEEDVGSPKLKLRKSGVSPKKSKYLTPLQQRLNEL
YDAVRNFTDRRGRRLSTIFLRLPSRAELPDYYATIKRPIDMERVRSHMAAGRYQDVDALV
EDFALMFNNACIYNEPESLIYRDALVLHRVLLETRKQQEGGEEFGPPAVGPLVRELIRNL
FVSVMGHQDEEGRCYSDSLAEIPAVDPAAPEKPPLNFDVIRMNVERGRYRRLDVFQEHMF
EVLEKARRLHSGRTDSEIFEDAVELQQFLIKIRDELCKNGEILLSVALNYTLKHLHSDVD
QEKREKIPKEIEEDKQKKDEDENQEDEKPEDLAGEAWQSKPEHVYSQDCRFENRTYHVGD
FVYVEPSEPNLQPHIVCIERLWEDEAGEKWLYGCWFYRPSETFHLATRKFLEKEVFKSDY
YNKVSISKVLGKCVVIFVKDYFKMQPEGFRPEDVYVCESRYTARNKFFKKIKIWAMPESS
VKLVPREAPLPVVRVASMFVKPDQDKTVAYTVNGFVDKEKEDVPTEMSGAEPGCQYYEQL
CYKNMWYKVGDCVYIQSHGLSKPRVARIEKLWQQNGTTFFFGPIFIHPEETEHEPTKMFY
KREVFLSHLEETLPMTCVIGKCVVSSFKDYLSCRPTEFSEDDVLLCESRYIESEKMMKKF
KGLKRFSYSSKVVEDEIYYFRKLIVPQKEASPILDKKIDELEVKLADMEDADDDMEDMDE
DEEAPETPSLPQMQTPLTNDMEVMPYTPSQTTPKVKGLSKKEGAKRKINMSGYILFSSEM
RAVIKARHPDFSFGELSRLVGTEWRNLEASKKAEYEERAAKIVEQQERERPPQKQASPRA
GTPVGALMGVVPSPSTMGMINQTMTPVSGMMGAYGPPYMTMQGPHEGLLSVAPMPPHPTG
GPHLPPHHLQQGMPGYPGMPHQGMMGAGMNGMAGSPAQGNFIQQPGMFSPGQHAPPPYPG
QGQLGQPSHLQPTTPMFVAPPPKTQRVLHSEAYLKYIEGLNSDSSTVSKWDQALKAQRRD
SHLTKEQESRLPAHWLKSKGAHTTMVDALWRLRDLMLRDSLNICQAHNL
Download sequence
Identical sequences I3J8P7
ENSONIP00000005237 ENSONIP00000005237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]