SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000005398 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000005398
Domain Number 1 Region: 714-896
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-41
Family SPRY domain 0.0021
Further Details:      
 
Domain Number 2 Region: 506-740
Classification Level Classification E-value
Superfamily RNI-like 1.18e-34
Family 28-residue LRR 0.0006
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000005398
Domain Number - Region: 74-266
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000256
Family G proteins 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000005398   Gene: ENSONIG00000004284   Transcript: ENSONIT00000005402
Sequence length 905
Comment pep:novel scaffold:Orenil1.0:GL831190.1:1208045:1215202:1 gene:ENSONIG00000004284 transcript:ENSONIT00000005402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRTGRTQRIKHKFKYSLKMKFQCVLEGISKARNPTHLNQIYTELNITDGDTTEVNNEHEV
RQLETSSRKVDRPETTIKREDIFKGLPGKKEVIRTVLTKGVAGIGKTVLTQKFTLDWAEN
ISNQDIQFTFPFTFRELNVLKEKNFSLVELVHHFFTDIKKAGICSFDEFRVMFIFDGLDE
CRFSLDFHNTEILTDATQFASVDVLLINLIRGNLLPYAHLWITTRPAAASQIPPEFVDMV
TEVRGFTDEQKEEYFRKRFKNEDQATSIVSHIKSSRSLHIMCHIPVFCWITATVLDDVRK
TREGAELPKTLTEIYIHFLVVQSKVRKIKYHGDAETDPHWNSESKKMIESLGKLAFDQLQ
KGNLIFYESDLMECGIDIRAASVYSGVFTQIFKEEXVFCFIHLSVQEFLAALHVHLTFIN
SGINLLEDQLKMPLLSKLFKSAIDKALESPNGHLDLLLRFLLGLSTQTNQGLLRGLLTDT
QRHFESNQETIQHIKKKIGENLSAEKNINLFHCLNELNDRSLVEEIQQSLRSGSLPIDKL
SPAQWSALAFILLSSENDLDVFDLKKYSASEEALLRLLPVVKASRKAVLSVCNLSETSCA
ALSSVLSLQSSSLRELDVNNNNLQDSGVKLLVIGLKNPHCRLETLRISGCLITEEGCASL
ASALTSNPSHLRELDLSYNHPGDSGKRLLSSGLEDPRWRLQSLRLEPAGVQWLRQGLRKY
FCQLTVNTDTVNRNLKLSDNNRNVTYVKENQSYPDHPDRFDQNHQLLCRDGLTGRCYWEV
EWSGGVHISVSYKRISRRGERNDSWFGGNPQSWSLFTDGGYSIWHDTKGTSIPSCSSSSS
VSGRVAVYVDCPAGILSFYRVSSDELIHLHTFNTTFDVDEPLYPGFGLWSWSYLSLASSV
RLCSL
Download sequence
Identical sequences I3J958
ENSONIP00000005398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]