SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000005419 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000005419
Domain Number 1 Region: 53-346
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.61e-58
Family Ankyrin repeat 0.00000652
Further Details:      
 
Domain Number 2 Region: 314-452
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.39e-20
Family Ankyrin repeat 0.0019
Further Details:      
 
Domain Number 3 Region: 529-580
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000288
Family SOCS box-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000005419   Gene: ENSONIG00000004299   Transcript: ENSONIT00000005423
Sequence length 586
Comment pep:known_by_projection scaffold:Orenil1.0:GL831197.1:2220938:2230411:1 gene:ENSONIG00000004299 transcript:ENSONIT00000005423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELDRFGIHDEDDEDDAATQYMIEQSLLESSKQKETHRNATTWDDRSSESADISKIFTAI
RQGNEKLLKDLCVRQKESFSLADSRGWTPLHEAASQSNQSILELMYKASGPDSVKCCTLR
GQTPLFLAVEHGFIENASFLLKHGASPDIQDDNQDSPLFVAIRLDRLDLVKLLLLRGSNV
HQEGCHGRRPLHEASRFGRMEMVKVLLEAGARPDPRSHYGLTPLALAAQDGHLEVVQILL
KKGADVFSQAQDEASILYEASASGNPAVISLLLEYGADANVAKHTGHMPIHRVAHRGHLE
ALQLLLPVTSMRDINDSGMSPLHSAAAGGHTNCIKVLLNAGYDPNYMLHPWVRRSYDDER
KSALFFAVSNNDMPSAKLLLEAGAMTNQDPVKCLQVALRMGNYELIDLLLRFGANVNYYA
RINTTHFPSALQYAFKDEVILRMLCNYGYNVERCFDCPYGNKPHIPEDYEGWSDSVIKDT
MFCEVITVSWLKHLSGHVVRVLLDYMDHVTMCSKLKAVLMEQKQWPDICRLQENARCLQH
LCRLRIRRSLGRLRLRSQVFMSFMPLPERLKDYILYREYDLLRGRW
Download sequence
Identical sequences I3J979
ENSONIP00000005419 ENSONIP00000005419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]