SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000005457 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000005457
Domain Number 1 Region: 14-200
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.33e-47
Family G proteins 0.0000278
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000005457   Gene: ENSONIG00000004329   Transcript: ENSONIT00000005461
Sequence length 210
Comment pep:known_by_projection scaffold:Orenil1.0:GL831170.1:2355628:2358728:1 gene:ENSONIG00000004329 transcript:ENSONIT00000005461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLLDKLTGWLGLKKKEVNVLCLGLDNSGKTTIINQLKPPNHSNHLGPLSEEWKHVSQTQ
AQEIVPTIGFNIEKFKSSSLSFTVFDMSGQSRYRNLWEHYYKESHAIIFVIDSSDKLRMV
VAKEELDTLLNHEDIRSKRIPVLFFANKIDLQDAMSSVKVSQMLCLENIKDKPWHICASN
AIKGEGLQEGLDWLQDQIAQSFENNEHMND
Download sequence
Identical sequences I3J9B7
ENSONIP00000005457 ENSONIP00000005457 XP_005452023.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]