SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000005471 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000005471
Domain Number 1 Region: 14-178
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.5e-51
Family G proteins 0.00000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000005471   Gene: ENSONIG00000004340   Transcript: ENSONIT00000005475
Sequence length 179
Comment pep:novel scaffold:Orenil1.0:GL831197.1:2428987:2431080:-1 gene:ENSONIG00000004340 transcript:ENSONIT00000005475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVIVSHIFSRLFSKHPVRILMVGLDAAGKTTLLYKLKLGEVVATLPTIGFNVETVEYKN
ISFTVWDVGGQTIIRPLWRHYYVNTQGLIFVVDSNDPERIKEASEELHTLLQEDELKGVA
VLVFANKQDLPRAMSVSDIIEALSLKGVSQPWSVQPSCAVSGTGLVEGLDWLSNEILKR
Download sequence
Identical sequences I3J9D1
ENSONIP00000005471 ENSONIP00000005471 XP_019214731.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]