SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000005498 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000005498
Domain Number 1 Region: 26-765
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.56e-264
Family Motor proteins 0.0000000000275
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000005498   Gene: ENSONIG00000004365   Transcript: ENSONIT00000005502
Sequence length 1043
Comment pep:known_by_projection scaffold:Orenil1.0:GL831356.1:676953:695552:-1 gene:ENSONIG00000004365 transcript:ENSONIT00000005502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRYQAREVDIEGRVRLVMESALTARDRVGVQDFVLLENYNSEAAFIENLRRRFRENLIYT
YIGSVLVSMNPYKELEIYSKQQMDRYRGVSFYEISPHIYALSDNTYRAMRTERKDQCILI
SGESGAGKTEASKKILLYYAVTCPTNDHMAALGDRLLQSNPVLEAFGNAKTLRNDNSSRF
GKYMDVQFDFRGAPVGGHILNYLLEKSRVVHQNHGERNFHIFYQLLDGGEDDQLNTLNLE
RNPQNYRYLVKGNCPRVSSISDKNNWKVVMKALPVIGFTEEEVQKLLNIIASVLHLGNMQ
FGEGEEGDTYITTEISNLARLLGVDGSALREALTHKKLTAKGEEMITPLNFEQAEAARDA
LAKAVYGRTFTWLVEKINQSLALKDEIYHSSKGSSVIGLLDIYGFEVLQHNSFEQFCINY
CNEKLQQLFIELTLRSEQEEYETEGIAWETVQYFDNKIICDLIEEKHKGIISILDEECLR
PGETCDVSFLEKLEDTVGGHPHFVTHKLANGKTRRVMSREEFRLLHYAGEVNYNVNGFLD
KNNDLLNRNLKEVMCQSDNQILSHCFRREEVIDQKRPEMAATQFKNSLMKLTEILRSKEP
SYVRCIKPNDAKQPGRFDEVLVRHQVKYLGLMENLRVRRAGFAYRRRFEAFLQRYKPLCP
ETWPNWHGRLVDGVLTLVKHLGYKDEEYKLGRSKIFIRFPKTLFNTEDALEAKKPEIALT
LQTSWRGYRERAKYQRIRRAVIVIQSGWRGMKARRRAKRRRQAADLIRRFIKGFIYRHEE
YGPENDYFMDHVRYSFLKNLRKNLPKSVLDKSWPTPPPSLVEASEHLRRLHMRNMVTKYC
RRVQPEWKKQMMQKVVASEIFKDQKDSYPQSVGRLFLDSRLEREQINLKVVQTLGNDKVQ
YGVSVIKYDRRGFKPRPRQLLLTNTFAVLVDKTKIKQRIDYTALRDIALSSLSDGMCVLH
IIREDNKQKGDLLLHCSHLIELVTKLAMMANKTSNVNINPGSIQFTVARGKEGIIDFVRG
AELKVTKGRRGHLLVTAPRINAT
Download sequence
Identical sequences I3J9F8
XP_013120545.1.78416 XP_013120546.1.78416 XP_019219386.1.78416 ENSONIP00000005498 ENSONIP00000005498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]