SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000005499 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000005499
Domain Number 1 Region: 227-481
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.01e-58
Family Decarboxylase 0.000000281
Further Details:      
 
Domain Number 2 Region: 8-201
Classification Level Classification E-value
Superfamily PRTase-like 3.15e-43
Family Phosphoribosyltransferases (PRTases) 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000005499   Gene: ENSONIG00000004366   Transcript: ENSONIT00000005503
Sequence length 485
Comment pep:known_by_projection scaffold:Orenil1.0:GL831155.1:1401404:1407959:-1 gene:ENSONIG00000004366 transcript:ENSONIT00000005503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGPSIDSLILKLHDVNGVKFGEYKLKSGLLTPIYIDLRVLVSHPALMNQVASLIYERVQ
EEGLQFDSVCGVPYTALPLATIICSQHELPMLIRRKEAKDYGTKRLVEGLFRQGDTCLII
EDTVTSGTSILETAEVLYKEGLKVTDAIVLMDREQGGVEMLASKGIKLHPIISISHLLRV
LQAAERIDAQTAQSVHEFIRDNNTFRPKNGTTSPASKKLCVEQKLKLSYSERAELPSIHP
LASKLLKIMEEKQSNLCVSADVTSSEELLQLAESLGPKICMLKTHVDILEDYTLAFIQKM
QALAEKHNFLIFEDRKFADIGNTVKHQYEGGLYQISSWSHIVNAHAVPGPGVVKGLSAVG
KPLARGCLLIAQMSSQGSLAAGEYTKAVVQMAEEHSDFVIGFICGSKLTERPEFIHMTPG
VQMQAGGDLLGQQYTTPEEVIYSKGSDVIIVGRGILGASDRVEAADLYRKSGWDAYRKRV
SQSSI
Download sequence
Identical sequences I3J9F9
ENSONIP00000005499 XP_005450464.1.78416 ENSONIP00000005499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]