SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000005599 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000005599
Domain Number 1 Region: 8-184
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.08e-27
Family G proteins 0.011
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000005599
Domain Number - Region: 7-43,174-266
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00915
Family Plasmid maintenance system epsilon/zeta, toxin zeta subunit 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000005599   Gene: ENSONIG00000004447   Transcript: ENSONIT00000005603
Sequence length 315
Comment pep:known_by_projection scaffold:Orenil1.0:GL831356.1:995950:1003348:-1 gene:ENSONIG00000004447 transcript:ENSONIT00000005603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATIDVEHSHVRFLGNLVLNL
WDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPDA
KVFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLACTCFRTSIWDETLYKAWSSIVYQL
IPNVQQLETNLRNFAQIIEADEVLLFERATFLVISHYQCKEQRDAHRFEKISNIIKQFKL
SCSKLAASFQSMEVRNSNFAAFIDVFTSNTYVMVIMSDPSIPSAATLINIRNARKHFEKL
ERVDGPKHSLHMRMR
Download sequence
Identical sequences I3J9Q9
ENSONIP00000005599 XP_003456844.1.78416 XP_004573375.1.88231 XP_005735678.1.53837 XP_005922077.2.24487 XP_006802180.1.46954 XP_010897123.1.71217 XP_010897124.1.71217 XP_010897126.1.71217 ENSONIP00000005599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]