SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000005611 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000005611
Domain Number 1 Region: 169-542
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.01e-65
Family WD40-repeat 0.00011
Further Details:      
 
Domain Number 2 Region: 1287-1407
Classification Level Classification E-value
Superfamily Bromodomain 3.14e-28
Family Bromodomain 0.00041
Further Details:      
 
Domain Number 3 Region: 1139-1247
Classification Level Classification E-value
Superfamily Bromodomain 1.23e-24
Family Bromodomain 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000005611
Domain Number - Region: 1638-1668
Classification Level Classification E-value
Superfamily ARM repeat 0.0575
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000005611   Gene: ENSONIG00000004457   Transcript: ENSONIT00000005615
Sequence length 1799
Comment pep:known_by_projection scaffold:Orenil1.0:GL831356.1:1019870:1037991:-1 gene:ENSONIG00000004457 transcript:ENSONIT00000005615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAREQCSQIEAELYYLIARFLQSGPCKKAAKILIEELEEYELVPQRWSWDGKKYKRNFQD
WVVVNQHIPADYLLRICQRIGPLIEKEIPPSVPGVQTLLGLGRQSLLRTSKSCSHKVCSG
SAVAALHRGRPPEPPVSNGSSPNVVSIMGARQATGTGRFGQVLPSSSYQHMKIHKRILGH
LSSVYCVAFDRTGRRIFTGSDDCLVKIWATDDGRLLATLRGHSAEICDMAVNHENSLIAS
ASCDKVIRVWCLRACAPITVLQAHAASITSIQFCPAARGTTRYLASTGADGMVCFWKWHS
LTMKFNDQPVKFMERSRPGVQVSTSSFSSGGMFMATGGTDHMIRVYYLGAESPMKVSEMD
AHTDKVVVVQFSNNSDSLRFVSGSRDGTVKIWHYQQQEWKSTTLDMAARLPGSTAATGDD
KAKLVVTMVAWDRTDSTVITAVSNYLLKVWSTSTGQLLHILSGHDDEVFVLEAHPFDSRI
MLSAGHDGNIYIWDLTKGVKIRNFFNMIEGQGHGAIYDCKFSADGQHFACTDSHGHLLIF
GFGCSRPYEKIPDQMFFHTDYRPLIRDSNNYVLDEQTQQAPHLMPPPFLVDVDGNPHPPH
YQRLVPGRENCKEEQLIPQMGYMANNDGELVEQVLGQQTAENGESPLDNLIRQLQNEQDE
RQNAERQAEGEEAGEGAEAVPSSPVVAPHRSGQVDGVWQMQHNALPSQVATERDLLAWSR
RVVVNEVPQGIFRVSEECRQAKGDIECSLYNAERKKKPVTCAPKSDLLSSRLRSLRPTKK
THKRHAYQTRSAQIRRPGTRSRNPSNRRTSNSQMDSESDGEQAEEQVEQTDASSDGDARW
QSESSSSDSSSEYSDWTADAGINLQPPKRPTRRPVQPPDYSSSEEEEGDNEAKEARTREK
EKRKKKSKETKQKPTSSLGGLDAEEWLPPSWIMETVPRRSPFVPQMGDELIYFKQGHQAY
VRAVRRAKAYSINPQKQPWNRLNLRDQESVKVVGIKYEVGPPTLCCLKVAFLDPVSGKMT
NESFSLKYHDMPDVIDFLVLQQFYNEAKEHNWQPGMRFRSIIDDAWWFGSVEDQEPLQPE
YPDSLFQCYAVKWDNGEREKMSPWDMEPIPEEAALPEQVGDGVEVAEEELKALLYEPQEG
EWGAHTRDEECERVIHGIDQLLTLDVAKAFAVPVNLQDYPLYCTVVAYPTDLSTIRKRLE
NRFYRRISALMWEVRYIEHNARTFNEPQSPIVAAAKVVTDVLLHYIGDQSCIDILDLYRK
LKSEVSSEAEVDLDVDSDTPGTSTGHRGGTANSKKRGVVLDPKAWRGQCRELLRRMTASM
DSEPFRQPVDLFEYPDYRDIIDTPMDLGTVSETLAVGNYENPMEFAKDIRLIFSNSKAYT
PNKKSQIYTMTLSLSAFFEKHIISIISDYKSAIQNERRARQHLTYRNRLHNGGSSPPNSP
SHSSKGKHKSGKASKPKKSQTSTKNRSQRSHKAQQSSSVAEEEDVQPSSPTSGTSVRSRN
RGPHRVTRSQATPVKKSGHQNNLHLSNGSRQRHLRETSQSDDEEEASGSNSSSLESSSTS
SSSSSSSSSSSSSDSDNSSDSEVEKYVEGGGDHDYSKAPCLSVRLSAKGKVAASGKRRHK
GGEDTEAQGPKRARLQLKVEEQEDEEEEEEEEEEAEEDEEEEEEEEEEEEEEEEEEEKEQ
QQQVDVKHEEEEDEEEEEEEEEEEEEEEEEEEEPEEDDNNSEVQTRAAAAASSQRDSQCK
SRRVNTRNQGRRTVRYRDDSEDEGHGSKDDPLNLGMSRSGRVRRMTEKARVSHLMGWSH
Download sequence
Identical sequences I3J9S1
ENSONIP00000005611 XP_005472032.1.78416 ENSONIP00000005611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]