SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000005632 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000005632
Domain Number 1 Region: 17-249
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.22e-36
Family Ankyrin repeat 0.00028
Further Details:      
 
Domain Number 2 Region: 272-317
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000405
Family SOCS box-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000005632   Gene: ENSONIG00000004473   Transcript: ENSONIT00000005636
Sequence length 319
Comment pep:known_by_projection scaffold:Orenil1.0:GL831155.1:2884016:2888617:1 gene:ENSONIG00000004473 transcript:ENSONIT00000005636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGRNLKEWLQEQFCDKPLEQDDMRLHNAAYVGDLDTLRNLLQEDGFRRRINEKSVWCCGC
LPCTPLRIAATAGHAACVAYLIAQGAEVDLVDVKGQTALYVAVVNGHLDCVRILLEAGAD
PNGSRHHRSTPLYHAARVGRLDILQELIRFNADVDMDHQLGPRLLLSARTLNTLVVCPLY
ISAAYHHLHCFQLLLQAGAQPDFNYTGPVCHEALTRGLASCLLDAVLRHGCEVAFIHLLL
DHGANPALVPWDESELEAPNRRKVDPEALRVFLEAKRNPRRLTHLCRIRIRRTMGKNRLN
HISSLPLPEPIKIFLLHQN
Download sequence
Identical sequences I3J9U2
ENSONIP00000005632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]