SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000005643 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000005643
Domain Number 1 Region: 387-591
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.41e-28
Family G proteins 0.015
Further Details:      
 
Domain Number 2 Region: 204-316
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000859
Family ABC transporter ATPase domain-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000005643   Gene: ENSONIG00000004482   Transcript: ENSONIT00000005647
Sequence length 758
Comment pep:novel scaffold:Orenil1.0:GL831409.1:811475:817858:-1 gene:ENSONIG00000004482 transcript:ENSONIT00000005647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEKQIVVINTPDLLLPNIYDVKLKEHVETCVRLSAPRPHVFLLVLQPEDFTEEQKQRLCK
VLEEFSDQSFDHSLVLKSTPREKSSAFMKEDQPLKDFIRKCKYRHLKLKNVERAELLTRL
VQIAKENNGHMDCDVFEDAATGRTSDQENLKQEKTSTFPFGPTKFWSMQPSSGAEKQEIV
KSTYLPTHTYTITSLLFSKLNPNKQCEVAHGEWKRKPVTVVKTPDMFSMTVKAIIEEMRS
CVSLSLPGPNVLLLLVKPSDFTEENRTRELETIQNTFSSRVNDFTMILFTVDSDPTDPAV
SNLKDNKDIQELCESCGGRSVVLNINDKQQIPQLVQAVEKVRAKSFTKDMFILAQMERVV
EQKNINTRLQAEMDLRKNRAMCVDDRNQNRECLRMVLIGKTGSGKSATGNTILGKQRFKS
RPSGRSVTKFCEKAEGEVDGRPVVVVDTPGLFDTSLSNDEVEQELIKCITMLAPGPHVIL
LVLSIGRFTNEEKQTVELIKKYFGKNSQHFIIVTFTRKDELKGQTFESYIENDSGEFVQK
LIHDCGGRYHVFNNNDAKNRAQVSELLTKIEVMVHKNGDSCYTSEMFQEAEVAIKKEVER
ILKEKEEEMKRQQEELEQKHKEQIKAMKKRMEEQRAETEQQRKLIEKQLKKKEDNIKHER
EQRKREQEREKKLKAESKEKETTDRQLEQSREEMRNHREKWEKERNKRKEEDRMRRDQEE
RERKELEENYKKKLQEMKTKYEEEARKQAEEFNEFRQK
Download sequence
Identical sequences I3J9V3
ENSONIP00000005643 ENSONIP00000005643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]