SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006220 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006220
Domain Number 1 Region: 309-680
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.38e-115
Family Motor proteins 0.000000145
Further Details:      
 
Domain Number 2 Region: 181-345
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000032
Family Tropomyosin 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006220   Gene: ENSONIG00000004944   Transcript: ENSONIT00000006224
Sequence length 691
Comment pep:known_by_projection scaffold:Orenil1.0:GL831289.1:79719:87865:-1 gene:ENSONIG00000004944 transcript:ENSONIT00000006224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTVYIPPKQKTPKDKTSIHTYGGGVWAISANHGKTLTKVVQFKFKRSRTEIPRTQKLLL
SPQQSMSRLPVMSSKRVLACSSAENAQDLAPAQKRLRKDADPVKPAATVIGTKRPALAAT
RAPLSRPLRAAGAATVAAAPSRGVIKQSVASAAAKGGNMKQPVASTGTKTGGTQKRNPWD
LKGKVSDMEDKVRNYQMKVKTLNQENEVLQDSVSQSQRKMVQVEKELQIQRSQIGEYERK
LQVLAGVQDELEKVLSDKNFLQKELTNLEGKYKVMETLRDSQETELQTLKMKLSVQESTL
ARVQANLRDSEEEVRSLKETVAQQKDEIYAGEMERRRLHNTIQELKGNIRVFCRVRPLVG
GGLPKHIQLATSDNKAITLAKTEESHTGKTADTQKNYNFSFDRVFGPRTSQQEVFEEISL
LVQSALDGYNVCCFAYGQTGSGKTYTMEGDEFDETRGVIPRAVQQIFKAAGKLGEQGWEF
TFTASFVEIYNETLRDLLYTGKSSKRPEHEIRKTASNEVTITNLTYERVINEDQVLGLIA
LANQNRSTAQTAQNDRSSRSHSVFQLDIEGVNAGRDVKCKSTLCLVDLAGSERMVKSQSQ
GDRFKEMTAINGSLSNLGIVIAALANKESYVPYRNSKLTYLLQGCLGGNSKTLMFVNIAP
EPDSFGETLNSLRFASKVNDCVIGTATANKK
Download sequence
Identical sequences I3JBI0
ENSONIP00000006220 ENSONIP00000006220 XP_005459136.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]