SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006299 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006299
Domain Number 1 Region: 680-788
Classification Level Classification E-value
Superfamily Bromodomain 1.16e-32
Family Bromodomain 0.00093
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000006299
Domain Number - Region: 62-120
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.0126
Family Bacterial exopeptidase dimerisation domain 0.012
Further Details:      
 
Domain Number - Region: 15-70
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0753
Family DNA-binding domain of telomeric protein 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006299   Gene: ENSONIG00000005008   Transcript: ENSONIT00000006303
Sequence length 865
Comment pep:known_by_projection scaffold:Orenil1.0:GL831183.1:2559599:2577439:-1 gene:ENSONIG00000005008 transcript:ENSONIT00000006303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STSAEHKLLVIGPTEPWSVREKLCLATSVMKSGDQNWVSVSRAIKPFAEPGRPPDWFSQK
HCASKYSELLEATEAPKRKRGEKGEVVETVEDVIVRRLTAERIEELKKLIKETQEKHRKL
KREAELIQAGHLDSKLKELWEEILQKKKLEEEEAETKRKNTDAAYQARQVAKNTPKRIPS
VTMHSPSGCSSPSQEFSPGDQLECLTLDLTSTKNASGTARLMTFTEPSGNDDINHGSLLE
DPTQKKLLCQKATPPPSPLLSELLKKGSILATNSRLIGDGDVSTGNVSGAHDLQLAPPCQ
PLSQAAGTDGAPMLSRLLEAGPAQFSPPLGFMVSADSASSVPLSATTPVPAESNISASAE
VNVMVPSVAPGCQPVSSMVEDKVSELSEDDVTVSYMGDELDLKTVGDIIAIIEEKADEAA
DALDAAAVEAALSLCEENGHALSAAWDSGPFQPHEPHNPTVPTGAIQSSSLHCSLEERTE
ASLSSFRNSQDNHLAGFPVGLRSIPPSSSSGCDSKILEHYRSGTPPQSAAVRETGEAVHS
KTQMSSVKCEREKWAQQIPEKIHGDSVLEDNPLTERHPKETKREDTITVGGGEKASGTNL
QNKVNGPEVCGEEVGDGVEEFLSEPDGETELEPAASESEDGYSLHTASSSLQLHTTADSI
PSSPASSQFSVCSEDLEALQAHKIWKKAIMLVWRAAANHRYANVFLQPVTEEIAPGYHSI
VHRPMDLATIKKNIENGLIRTTAEFQRDIMLMFQNAVMYNSLDHDVYHMALEMQRDVLEQ
IQQFLATQLIMETSESGISAKSLRGRESTRKQDSTDKKKYLPCYQREQYEKYRRSRANAA
LTTVDSDGGTRGRRSAIEADLKMKK
Download sequence
Identical sequences I3JBQ9
ENSONIP00000006299 ENSONIP00000006299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]