SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006329 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006329
Domain Number 1 Region: 9-186
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.87e-18
Family G proteins 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006329   Gene: ENSONIG00000005033   Transcript: ENSONIT00000006334
Sequence length 200
Comment pep:known_by_projection scaffold:Orenil1.0:GL831450.1:507783:508697:1 gene:ENSONIG00000005033 transcript:ENSONIT00000006334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFANYYRRHTGTTVNLVLLGMAGTGKSASGNTILGQKLFVSRPSSTPVTTKCQNKQTEIN
GVDVNVIDTPDIFDDDIAPSVRGKHVKRCKQLCQSGPCVFVLVMHVSRFTDGERDIMEKL
EKAFGREVRGRTIILFTRGNDLQQAGMGLEDFLHSCQPDLKKMVEKCGNRCVLFENNKSG
PDQVEKLMTVVNTILKDQNN
Download sequence
Identical sequences I3JBT9
ENSONIP00000006329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]