SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006336 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006336
Domain Number 1 Region: 40-218
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.16e-21
Family G proteins 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006336   Gene: ENSONIG00000005037   Transcript: ENSONIT00000006341
Sequence length 226
Comment pep:known_by_projection scaffold:Orenil1.0:GL831450.1:586976:589090:1 gene:ENSONIG00000005037 transcript:ENSONIT00000006341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLQQRLCLNIRMTDKPVPPLPAPRTEIAMAGKRTSIKVNLVLLGMSGTGKSASGNTILG
KPVFFSRPSSKSVTRDCEIAETEINGKHVRVIDTPDMFDDETEESVKNKYLKRCKELCES
HPCVFVLVMHISRFTDGERNILKQLEKAFGRNVKEQSVILFTKGDDLHRAGKTLTDVLHS
CQPDLKEMIQQFGNRCVLFENNRSGSAQVEKLLDTVIMVLEKQQKL
Download sequence
Identical sequences I3JBU6
ENSONIP00000006336 ENSONIP00000006336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]