SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006342 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006342
Domain Number 1 Region: 1107-1414
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.06e-24
Family Quinoprotein alcohol dehydrogenase-like 0.033
Further Details:      
 
Domain Number 2 Region: 1351-1674
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.22e-21
Family Quinoprotein alcohol dehydrogenase-like 0.024
Further Details:      
 
Domain Number 3 Region: 391-474,541-706
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000595
Family Tandem AAA-ATPase domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006342   Gene: ENSONIG00000005042   Transcript: ENSONIT00000006347
Sequence length 1716
Comment pep:novel scaffold:Orenil1.0:GL831147.1:1031897:1042420:-1 gene:ENSONIG00000005042 transcript:ENSONIT00000006347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSYLNSSCLSGMHTGGKSPLDSGFSTSCVKIYLCSNPEDSVVERRALRETVFPRFREHC
RHSLGLDVRVIDPFESSDPSRWPDEDTRHQMIHECRGSSAGPFLLALVGHQYGTARLPAQ
VEVPELQLLLQQCQEAGVSTQELEKVYQRDENTIPTTYCLRAPHRRSYSLQERNKVKEES
KTKTKDEELRKLFQAAVSLCVQSGSMTPERAKSFYRSALDADLCYALESCPERDIARRCL
VYVHKIFNAKAERQKGPVKIQLQSKLEDATLSSSPTNEKLLSELCESFLPRLVTSRQLLV
YTITTECDRRHGYTSARRRGYADSLCQQVYCDLVQMTDSLNVSQSAEPSPFGDALSREQA
EQEQLCHILSRFYDVIQPEEEKVRAYVKQRYHQFPLVVTGGPCTGKTVLLAHCTQQMKRW
LADSDPVVISFFCNLSINASPKHLLSSLCYQIACRYHSDSSSKQDASLCSDLDDPGSTTD
PREVTSSCSPSSVLDSQHERGTKEHVSDCEQSWSTAQHPGQRQLDFGNIKPDACLSELKE
HLSSLISHLPSTEKPLVLILDGLDQLKNNTGLQIIESLPRPIPPAVKLIVTASSNRAHFL
QAIKLHYASHSVTEDMWTGRLCIQLGLVDRKQSVQMLASLLKGSGRRVTSGQQALVNQAL
ARCCLPLYARLLHAHTSLWHSDSDVTESSLPDGVHSSISALLDHLEQKHFSSVVARAISY
LTLSRSGLTEAELADLLSIKEDWPHIGSPFKMTVPQVDVERLLLDLKSFLIQRKVAGSLV
LFWVSRHFKLVVAKRYLDAPDVRRRLHSQMADYFSGQTSGVNKDAALKTHTDTRQPSQPF
VFTSIKRGGRVNVRKIVELPYHLQQSGRWKEFERMLLLSFGFHQAMLRAGLLGDLLAMLE
AEEESSQVKFVRERLLLASTLKSSACFLQSSPLQLPAVMETNLLPYLEVFPALEGYVREI
KEGRGSGLGIALCPSPPRVPHIQYLKYDDINKDVCVREIAGTKCGVVAEITDDGSAWIWK
GCGYDVAKLSLRCEETELKFAGVKSSGPFLLLSTSCSKLFVWDVEGPEKFLEVKDPFKNT
CESSETPSNIEGFAAHQKTLSVWWKDESFVSVFDISSETLTHFQCQSPVTCSVFSSDGFF
MYCGQEEGTVSVFDMKSSSLLSTCSNSNHSAVTLIILHEDKREMACVDRTGSVALWDVAA
DAQPPRLVKESFTQGYSTNILSTDYSSEINTLLMCQAHQASLWDTCNWELWDQFLAPQGR
AFTQAVLSQDGHLFLALLDTCTFVLVWRVSSGECVLSLETNKQPHTLLKMASDVICVSHD
GCLTVWDSEMIDAAGSAQKMGGGVKEVVVEQTGVWFYTRDGSEKVWKWSLDTGLPHVNFL
HIGPVEKLQLSPNGIHLVSLSAGDIYVWRTETGENILRIGGSRARDILITPNNNFGVSIS
ERGLSRVFKIAQGNIVCSIHPYLSDAQVSPESTYLLGCCHGDLLAASLWSGSISKRFSCV
ESSEEVVAFQTLSQHPEFVVVMAASGTVYTWKVAEETVCWHFQLPHMFHCQPEDFQMSSN
GSYALLSIDSGAINLLNLSRVTLCSFKVEGPVIKACLDKTGRYVAYITTPSGLEDGCDCY
LHARPILQVMRLSDGERLGAVHLSKNPLALVICEQHCVFVGFGDGSVGVYYISDVTVDED
EPIRCWEDPSGQLKQCPFDRMPFSWFPQDTPNVTWP
Download sequence
Identical sequences I3JBV2
XP_005474730.1.78416 ENSONIP00000006342 ENSONIP00000006342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]