SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006399 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006399
Domain Number 1 Region: 124-184
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000861
Family Atu3015-like 0.086
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000006399
Domain Number - Region: 125-149,250-326
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0173
Family Atu3015-like 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006399   Gene: ENSONIG00000005089   Transcript: ENSONIT00000006404
Sequence length 441
Comment pep:known_by_projection scaffold:Orenil1.0:GL831165.1:2517110:2520629:1 gene:ENSONIG00000005089 transcript:ENSONIT00000006404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATEGVEKTSEDAPAAGKASTRYDLEKETELRFEVESGEAAEQVELELLTGMAEVFGSEL
NRNKKYTFGPGSKIAVFTWQGCSVNLYGKPEVAYVSKDTPMLLYLNTHAALEQMRKQAER
DNERGPRVMVVGPTDVGKSTVCRMLLSYAVRVGRRPTFVELDVGQSGVSVPGTVSALCIE
RPADVEEGFSVQAPLVYHFGSTSPGTNIKLYNKLTSCLAEVFSQRCEVNRKASVGGCIIN
TCGWVKGSGYQALVHCASTFQVDVVLVLDHERLYNELKRDLPHFVRVVLLPKSGGVVERS
KECRRDTRDEKIREYFYGFRGVTFYPFSYEVRFSDVRIYKIGAPSIPDSCLPLGMSQDDT
QLKLVPVTPGRDLTYHVLSVSSAEDGDEGARKGIVESPVCGFIVVTHVDTQAQVMKVLSP
APRPLPRHTLLIMDIRFMDMK
Download sequence
Identical sequences I3JC09
ENSONIP00000006399 ENSONIP00000006399 XP_003444745.1.78416 XP_013126437.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]