SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006476 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006476
Domain Number 1 Region: 200-459
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.47e-80
Family RecA protein-like (ATPase-domain) 0.00013
Further Details:      
 
Domain Number 2 Region: 470-570
Classification Level Classification E-value
Superfamily C-terminal domain of alpha and beta subunits of F1 ATP synthase 2.88e-25
Family C-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0035
Further Details:      
 
Domain Number 3 Region: 16-86
Classification Level Classification E-value
Superfamily N-terminal domain of alpha and beta subunits of F1 ATP synthase 5.1e-16
Family N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006476   Gene: ENSONIG00000005153   Transcript: ENSONIT00000006481
Sequence length 617
Comment pep:known_by_projection scaffold:Orenil1.0:GL831183.1:2872469:2880409:-1 gene:ENSONIG00000005153 transcript:ENSONIT00000006481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTSKLPKIQDEDRESQFGYVHGVSGPVVTATAMAGAAMYELVRVGHSELVGEIIRLEGD
MATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGSIFDGIQRPLKDINDLTNSIYIPR
GVNIGALNRNIKWEFTPGQSLRVGSHVTGGDIYGMVFENSLIKHKLMLPPRSRGTITYLA
PPGNYDISDVVLELEFEGIKEKLSMVQVWPVRQVRPVTEKLPANHPLLTGQRVLDALFPC
VQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLRDFPELTMEVDG
KVESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALRE
ISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNPEREGSVSIVGAVSPPGGDFSDP
VTSATLGIVQVFWGLDKKLAQRKHFPSVNWLISYSKYTRALDEYYDKHFPEFVPLRTKAK
EILQEEEDLAEIVQLVGKASLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGI
LSNMIAFYDMARHAVESTAQSDNKITWAIIRENMGEILYKISSMKFKDPVKDGEAKIKGD
YAQLLEDMQNAFRTLEE
Download sequence
Identical sequences I3JC86
ENSONIP00000006476 ENSONIP00000006476 XP_003446891.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]