SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006480 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006480
Domain Number 1 Region: 1-53,161-259
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.58e-17
Family G proteins 0.099
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000006480
Domain Number - Region: 2-22,265-348
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0566
Family G proteins 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006480   Gene: ENSONIG00000005156   Transcript: ENSONIT00000006485
Sequence length 607
Comment pep:known_by_projection scaffold:Orenil1.0:GL831217.1:447127:452293:1 gene:ENSONIG00000005156 transcript:ENSONIT00000006485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGVFGKTGAGKSSLINAIINNEGLLPSGSVSACTSVMIKVEATNGSKYEAHIEFITKEAW
KSEVDSLKQAFEDNDNDYDDGGNDVVFDPDGKLSALYGDEWKEKNTGSLIDNNKYFPDIP
EFRKSKIKILESDSAEGLSEEFVKYTRSESNESEEVKRWYWPLVKCVTVKVPDNDFLDHV
TLVDLPGNGDTNSSRDRMWTEFVASCSTVWIVTEMNRAASETEAWEILEDASSLLGNGGE
CQQIHFICTKSDNENPDDLLFNGSFHYGATTMHTNAYTLNENNRNFPLQNKVKNAVMNEF
KKRKLIKDHFSEDSFKVFTVSSKEFLKGENVNPDLNEIPKLKEILKNLNDTHSKTLNYVS
GAYGILSLIQGARSGEVVEQKNDVCADLEGNLSIQLNQVKKAIEGIIKVFEERLSEGVEK
SQTLCKQKLRSFLHPSKTSDRAFHRTLKFAVRNDGVQKPKKGKRKNLNVTLVSCLTESID
KEFRKTFPNNIKCGHFNGAIDAFSLSTDSLIEKYKDVELQLTFLQTEEKKMKTKLNETIL
TRKKLIYNSLTETIKDNMKECYKEAATFKGTGTLKNMRDTIERHVESKMDMFEEAKNVML
EQLNDLK
Download sequence
Identical sequences I3JC90
ENSONIP00000006480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]