SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006648 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006648
Domain Number 1 Region: 172-344
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.18e-38
Family G proteins 0.0000198
Further Details:      
 
Domain Number 2 Region: 59-176
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 3.4e-32
Family Transducin (alpha subunit), insertion domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006648   Gene: ENSONIG00000005286   Transcript: ENSONIT00000006653
Sequence length 351
Comment pep:novel scaffold:Orenil1.0:GL831217.1:1622619:1633503:-1 gene:ENSONIG00000005286 transcript:ENSONIT00000006653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSCLNVLPAPLQLCLGMCLHKDVAEEHKRAKLQSSKIERDLHKHASMDNNVVKILMLEL
ISFKPAVLDNLLTSMKTVLQGMGTLRINLANKQNKDHARSILSCSQCLGDDQELLPFMAH
AFCALWSDQGVRAAAARGYEFELNDSALYFFENMSRIIAPNYVPTDADVLRVRVRTCGIV
ETQFQVDKTMFRLYDVRGQQSKRRKWLSCFEGIQAVVFVVALNSYDMTLLEDPSVNRLQE
SLELFSSICMHTVLQRTTMILFMNKTDLFREKILKSRRHLRLYHSSYKGADGDVDAAAHH
ITAMFSACNSNPDRPVYHHFTTAIDATSVQVAFHVVVDQIMRGNIEAVQLV
Download sequence
Identical sequences I3JCQ8
ENSONIP00000006648 ENSONIP00000006648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]