SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006811 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006811
Domain Number 1 Region: 163-348
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.64e-19
Family SPRY domain 0.032
Further Details:      
 
Domain Number 2 Region: 4-42
Classification Level Classification E-value
Superfamily SAP domain 0.0000000568
Family SAP domain 0.0013
Further Details:      
 
Domain Number 3 Region: 387-524
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000741
Family Nucleotide and nucleoside kinases 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006811   Gene: ENSONIG00000005422   Transcript: ENSONIT00000006816
Sequence length 624
Comment pep:known_by_projection scaffold:Orenil1.0:GL831165.1:4598428:4605042:-1 gene:ENSONIG00000005422 transcript:ENSONIT00000006816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLADIKKLKVAELRSRLKELGLDSRGLKAELVERLWSAAEGEQSGGDGEEESLKLHDSS
PILLVQTEPADVRPPSSEIGATARHEVDRGYTDMATQTEAEPSPAAPQPGSEAAAAGVTA
CPAEGGEQGHAEGPVEEDMGRGRSFYEFKEEIRYKRAKSPQPPAERSEAEEQDEDKVRLD
KYGSHLHFEVSPDGSSGQPRFWAQFPLLWSGCRLTHGVQQGRVGFEVRLERKLLTAQPDD
HEVREPYGLRVGWSVADSSLLLGEDELSFCYDGRGKKVSDRKEENFGEPFSEGDIIGCYA
SFSSDGAVELSFHKNGRFVGVAFSTDTSVLRGRALFPHVLCKSCSFKLLLDPAAQPWYPG
PPGFTPLATLPPGQRVCSTSGPTSRAQCEVVLMVGLPASGKSVWARNYMKQHPEKQHRLL
GTEELLAYMIVSQIPNLYSCDSRSHSEIMVHTEIIKIAAQTPGNYILDQCNILFSALRHK
LRLFTGFRRRVVVVFPSADEWKRRLLQHQMRDGEHIPETALLKLQVSCSLPEQQDDLLEE
LQYIELPQEKALKLLQEYKDEARRLLPPVPKHEKTRRLYRKRPHPHGPPSSHRSSMQTWS
QPPRYWSVPYQDQRYYYSAYQSYS
Download sequence
Identical sequences I3JD71
ENSONIP00000006811 ENSONIP00000006811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]