SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006852 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006852
Domain Number 1 Region: 169-545
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.21e-72
Family WD40-repeat 0.0001
Further Details:      
 
Domain Number 2 Region: 1304-1422
Classification Level Classification E-value
Superfamily Bromodomain 1.57e-32
Family Bromodomain 0.00025
Further Details:      
 
Domain Number 3 Region: 1155-1267
Classification Level Classification E-value
Superfamily Bromodomain 3.53e-25
Family Bromodomain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006852   Gene: ENSONIG00000005455   Transcript: ENSONIT00000006857
Sequence length 2235
Comment pep:known_by_projection scaffold:Orenil1.0:GL831147.1:4389724:4416870:-1 gene:ENSONIG00000005455 transcript:ENSONIT00000006857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKNRNISLLESELYYLISRFLTTGPCRRAAEVLASELEEYQLLPGRLDWLGNEHPRTYE
DVVAANRHIAPDHLLQICKQIGPLLDKEVPSCVPGVHSLLGSGRQSMLRTAKDCDSVRFK
ASSYAALHRGRPPERPLNCKKPPQLVKVHRGRELTGAQRFSSICPVSNYEHMRLHRRILG
HLSAVYCIAFDRTGLRIFTGSDDCLVKIWSSFDGRLHSTLRGHSAEITDLAVNYENTLIA
AGSCDKTIRVWCLRTCAPVAVLQGHSGSITSLQFSPFAKGSKRYMLSTGTDATVCFWQWD
ANNINFSDRPHKFTERPRPGVQTVCSSFSPGGMFLATGSTDDVIRIYYLGSGSPEKISEL
HEHTDKVDSIQFCHSGERFVSGSRDGTARIWKLHQRQQWRCILLNMSATIPGVEPMSEEE
SYFKPKVTMVAWDRHDNTVITAVNNHLLKVWNSYTGQLLHILKGHEAEVFVLEPHPFDPR
IILSAGHDGNVFIWDLLRGTNTQHYFNMIEGQGHGAVFDCKFTPDGQRFACTDSHGHLLI
FGFGSSKPYEKLPDQVFFHTDYRPLIRDANGFVLDEQTQQAPHLMPPPFLVDVDGNPHPP
RYQRLVPGRENIAAEHLVPQLGYVATSDGEVVEQVISQQTAEPEEIAVRRSSLLDEAIRQ
LQEQQDRQNQPGTGAVPEGPAEAQGPVLAPAPSTPRRVSVNDRADVQSPPNVGLRRSGQV
EGVRQMHQNAPRSQMATERDLQAWRRRVVVPELPPSSYRDQEDVRVARGDEEVVQYNAKK
RRIMYSSCRDDSDEEPSTAKRAHSRGDALEYIDESCEEGEETASSEMHSEDNELDGSDLE
SSNDEEEWKSDSSSHTSSEYSDWTADAGINLQPSTPLSSRKRVRCRLSSSEEEEEENEEE
EEKQQSDEEERPKKKGKEKAKKAKNKSPRRPKPRPSINREVSNEFRPSPWITDVIPRKSP
FVPQMGDEVIYFRQGHEAYVEAVSRSELYHINLEKQPWKRMELRDQEFVKITGIKYEVCA
PTLCCLKLTLIDHGTGKITDKSFSIKYHDMPDVIDFLVLRQCYDEALRRNWQPNDRFRSV
IDDAWWFGTIICQEPYQPEYPDSLFQCFKVKWDNGETEKLSPWDVEPIQDDAPQPDTEGG
GIPVTAEEMRELMYKPLPGEWGERSRDEECERVIAGIDQLITVEIAAPFSGPVDLVQYPT
YCTVIAYPTDLGTIRLRLINRFYRRLSALIWDARYIAHNARTFNEPRSKIAHSAKIITNV
LQKFVNNPSCTDIMEIYNEVEEMDDDDEEEDTEAPGTSAGHRLRQRSVEVLPDRDAWKEQ
CKSLLNYIFECEDSEPFRQPVDPQNYPDYHDIIDTPMDFGTVKRTLEEDRYENPTELCKD
TRLIFANAKAYTPNKRSKIYSMTLRLSAFFEERIRTIISEYKTAVKSSNRLRRSQRFRKK
ILQQQDHPDTTTSQKKAAVKTQEKVESVSVTKTTSAKVSVPERARRSRSSSSGHSSSEDD
SGSKGASSTSESDSESEVSDSEEENHQPRHKARVTRSNHAKQRKKVAESDSEEEEEDDEE
EEEFDSEGEEGEDGEASSTSDRRYPSRSTRRTRNSAAGDRKRAECRAEMNGHSSRSSCRE
RRPRCDSDRATSQGSDREEVTVRGSLQRKTARAAVNKMKLLEASDEDYHEEEEKPRRSSS
RRRHTARVSKRTAVLKSSSESDEESAAASQNTKESGSEFKDEEDGNDSDTSSFSQSKQNG
NTKNSKQAAKIKKNGTLSRVNGHSAKHHTPKSNSEQEETPGESSGEAEEEEQQPPLSQKP
SRSTAAAPVRKSRSTSEEEEETKDIRHLSTRHKPPVSSDEADKRPHQNGRNVEEAVHKDP
KKKSKVSPSKSQDKQKSASTHKLDGAESDELCDSPKRSSPRKKRPKKGNEQDAGSKRSSD
ESDLETRTKRPTRNRSICKRPRGDSSASQSSEQEYKPKRKSRRKRSTGSSDQESDNSENT
PNRRLSLRALPKKKYISDNSFSEEDSASAKPGRRRTGNRAAIESREDGYNTRVSNRTSPS
ETRNRVSSKRKCIYTSDSDDGDEDGEKEPVSKSNKNSKSGPSKYAKKDTKRGNSNEQDTS
SHSDSSEEEEKEEEEEQEEHLSRSTRGKKSVRQPKCKRKESYSSSKHSSDSESEQSSSAS
ENSFASSGSHSSPKRRSRTRSGIGERTASRQLRQRRQRSASEEEDSDESYSKPRRKTRVN
TRNRGKRTVKYNDSE
Download sequence
Identical sequences I3JDB2
ENSONIP00000006852 ENSONIP00000006852 XP_003441746.2.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]