SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006853 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006853
Domain Number 1 Region: 169-545
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.01e-72
Family WD40-repeat 0.0001
Further Details:      
 
Domain Number 2 Region: 1303-1421
Classification Level Classification E-value
Superfamily Bromodomain 8.9e-33
Family Bromodomain 0.00025
Further Details:      
 
Domain Number 3 Region: 1154-1266
Classification Level Classification E-value
Superfamily Bromodomain 2.09e-25
Family Bromodomain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006853   Gene: ENSONIG00000005455   Transcript: ENSONIT00000006858
Sequence length 1439
Comment pep:known_by_projection scaffold:Orenil1.0:GL831147.1:4394787:4416625:-1 gene:ENSONIG00000005455 transcript:ENSONIT00000006858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKNRNISLLESELYYLISRFLTTGPCRRAAEVLASELEEYQLLPGRLDWLGNEHPRTYE
DVVAANRHIAPDHLLQICKQIGPLLDKEVPSCVPGVHSLLGSGRQSMLRTAKDCDSVRFK
ASSYAALHRGRPPERPLNCKKPPQLVKVHRGRELTGAQRFSSICPVSNYEHMRLHRRILG
HLSAVYCIAFDRTGLRIFTGSDDCLVKIWSSFDGRLHSTLRGHSAEITDLAVNYENTLIA
AGSCDKTIRVWCLRTCAPVAVLQGHSGSITSLQFSPFAKGSKRYMLSTGTDATVCFWQWD
ANNINFSDRPHKFTERPRPGVQTVCSSFSPGGMFLATGSTDDVIRIYYLGSGSPEKISEL
HEHTDKVDSIQFCHSGERFVSGSRDGTARIWKLHQRQQWRCILLNMSATIPGVEPMSEEE
SYFKPKVTMVAWDRHDNTVITAVNNHLLKVWNSYTGQLLHILKGHEAEVFVLEPHPFDPR
IILSAGHDGNVFIWDLLRGTNTQHYFNMIEGQGHGAVFDCKFTPDGQRFACTDSHGHLLI
FGFGSSKPYEKLPDQVFFHTDYRPLIRDANGFVLDEQTQQAPHLMPPPFLVDVDGNPHPP
RYQRLVPGRENIAAEHLVPQLGYVATSDGEVVEQVISQQTAEPEEIAVRRSSLLDEAIRQ
LQEQQDRQNQPGTGAVPEGPAEAQVSVNDRADVQSPPNVGLRRSGQVEGVRQMHQNAPRS
QMATERDLQAWRRRVVVPELPPSSYRDQEDVRVARGDEEVVQYNAKKRRIMYSSCRVAFE
TALFSPMLNHSHLSPQDDSDEEPSTAKRAHSRGDALEYIDESCEEGEETASSEMHSEDNE
LDGSDLESSNDEEEWKSDSSSHTSSEYSDWTADAGINLQPSTPLSSRKRVRCRLSSSEEE
EEENEEEEEKQQSDEEERPKKKGKEKAKKAKNKSPRVREVSNEFRPSPWITDVIPRKSPF
VPQMGDEVIYFRQGHEAYVEAVSRSELYHINLEKQPWKRMELRDQEFVKITGIKYEVCAP
TLCCLKLTLIDHGTGKITDKSFSIKYHDMPDVIDFLVLRQCYDEALRRNWQPNDRFRSVI
DDAWWFGTIICQEPYQPEYPDSLFQCFKVKWDNGETEKLSPWDVEPIQDDAPQPDTEGGG
IPVTAEEMRELMYKPLPGEWGERSRDEECERVIAGIDQLITVEIAAPFSGPVDLVQYPTY
CTVIAYPTDLGTIRLRLINRFYRRLSALIWDARYIAHNARTFNEPRSKIAHSAKIITNVL
QKFVNNPSCTDIMEIYNEVEEMDDDDEEEDTEAPGTSAGHRLRQRSVEVLPDRDAWKEQC
KSLLNYIFECEDSEPFRQPVDPQNYPDYHDIIDTPMDFGTVKRTLEEDRYENPTELCKDT
RLIFANAKAYTPNKRSKIYSMTLRLSAFFEERIRTIISEYKTAVKSSNRLRRSQRFRKK
Download sequence
Identical sequences I3JDB3
ENSONIP00000006853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]