SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006936 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006936
Domain Number 1 Region: 50-224
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.87e-46
Family G proteins 0.0000773
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006936   Gene: ENSONIG00000005519   Transcript: ENSONIT00000006941
Sequence length 254
Comment pep:known_by_projection scaffold:Orenil1.0:GL831384.1:151429:197831:-1 gene:ENSONIG00000005519 transcript:ENSONIT00000006941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPPVKKDRVITQLPKCFSANAALHTKEGFHPHVKAACQVQKAGIVSFNVAKVIVVGDVA
VGKTCLISRFCKGAFEKNYKATIGVDFEMERFEVLGVPFSLQLWDTAGQERFKCIASTYY
RGAQAIIVVFDLSSVGSLAHARQWLEDAMKENDPSSVLLFLVGTKKDLSSPDLLAQIEQE
AMRLSEEIKAEYWAVSAKSGDGVKDFFFRVASLTFEANVLSELERSGSRHVGDIIRITDS
TETSHKPKKKPNCC
Download sequence
Identical sequences I3JDJ6
XP_003457578.1.78416 ENSONIP00000006936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]