SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006940 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006940
Domain Number 1 Region: 1970-2157
Classification Level Classification E-value
Superfamily BRCA2 helical domain 1.7e-74
Family BRCA2 helical domain 0.000000498
Further Details:      
 
Domain Number 2 Region: 2327-2461
Classification Level Classification E-value
Superfamily BRCA2 tower domain 1.07e-47
Family BRCA2 tower domain 0.0000723
Further Details:      
 
Domain Number 3 Region: 2159-2296
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.88e-42
Family Single strand DNA-binding domain, SSB 0.00000746
Further Details:      
 
Domain Number 4 Region: 2550-2688
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.86e-38
Family Single strand DNA-binding domain, SSB 0.00021
Further Details:      
 
Domain Number 5 Region: 2299-2327,2462-2549
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.08e-28
Family Single strand DNA-binding domain, SSB 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006940   Gene: ENSONIG00000005522   Transcript: ENSONIT00000006945
Sequence length 2832
Comment pep:known_by_projection scaffold:Orenil1.0:GL831218.1:289993:303706:1 gene:ENSONIG00000005522 transcript:ENSONIT00000006945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYETFKDEIWKELGPLDHNWFDILTAQTSANEGGSGSDQDELCANQEGHFKTPLDKTAVD
SQLFSTPRVFRHSRIVSPEIEDGQSFSTTQENDTSPWTETQSPYLFQMSKKGVSDTKYEE
IQPQSQDSFDPLDTPHKSPMSYAKHISESLGAQINPDISWTSSLNTPPPVPSTLILSKVD
ESPCPVSVSVDKSVVFVRKLFPSLSNPSRIVVAPPKNALSSTDAVLPEVVSSQTLLTQNE
GIWQQTLRGANGDGKICSTVASAPDEFQNASSTFLANSSSALRKVKPDRIRWKQFKLSEH
DCSSTDISKTNQSNEEHKADEEHSTIPSSPLAKNGSTAISQWSPLNLSEIPPCTAENNIL
TELQPDFDPRQLVRPPIKITDTGFIRKKRKFVYTVETLKPKVKENETDFQKMNASSGIPD
TVKIEVFLFSTVTEKFSSFLLGPELSSKQSEDAPDEASCCSNERNAEEKQEKSTLENLPS
SVQEKVQDLDMSQLHKDFAQDFSQISDSGRRTEGVAEDQNHFSPSACLLAMKKAKHQTKQ
ASLHHDYNSISNTGHMSTTNQNYSTNEGTISDSGFQSAVADITHTASSCIVPCSENTGSK
TDIHRTTPFPSTHRGNEKSQLKERQTIDSERECQLDMESTLTQLPSSLKGTDDGLNWIPQ
NGQVHGRLLEKTGVSLPPAHASGFKTASNKGIQISLANLEKARNLFEERDGDQPTKCNSA
TKHKNSQSNGSMKSTVSVSNQQTSVSERFEGISCHLTASQKADVTELCTLLEEADSQFEF
TQFRGAEVKQPCQKTDKDLDPDFLADIDFDDSFSSDAEKHFAITAMPDKMTRENISAGDV
LSSSENIPGRSNWLISTKQKSLHRAEHGEASKMEKPNPLMLSVAFKTAGGNALRVSKTCL
SKARALFADLEINVSDLNRSHKQAAETGAKSKKMCNVDSETATDTKQPVSALKQARNMQD
KDTTKSFEICKKDAIVNIEFENVNSGLSRPHPDDIEMKSVGCNTVLEFKNPVSFHETPFS
TSKLLPCPASKSIDSSAISELSSGYGFCTASGKTVSVSADAMKKAKCLLNDTYTLEDTSK
KISQKENALRTAQLTAQNKESIPKTSGFDTATGKGVSISSTAHKKAKCPLSESDKDFEDS
VLTNAMQETVDCDIDVNNGGNIVHISGSDSDLGIRPDQRVTSNISVESANKQVKQKDSLP
LKSGGFGPVSGKGVSISSEALNRATSLLGQCDEVNNKINVNQSHLKTSVYSPLPTSGGFH
AASGKALTLSSEALQKAKTLFSDCREPSCSTHTEHKKLCKVWKWMRSGKPSCSKTPVPEN
GGFLAASGKPVALSSEALQKAKTLFSDIISSAESPHAKNEMQSGFKTASGKKVHVSQKDL
LNAKHLLKDLDDSVFTKAMQMAEDCDMDLQTASGKGVTIASEALRKARSLLGECDEVEDK
IVHDSLPQNGGFCAASGKPVALSSEALERAKALFGDIGISAEIPHAKNSHKKYDYGENTW
KMQCSSKTVGEKDSGNGCTEVTNEHMKQKNTWPQQSVGFQTASGKGVAVSSEALKRAKTL
LSECEGVEDKISITAPQGKISAHGPPFRSSGFLAAGVKPVALSSEAMQKAKALFSDISQS
RDTPAVAHTRKNDKKIDAHNGEEMHCGFSTAGGVKVQVSKKSLLKATSLFKEFDDGECHD
SLLFSTSPQDYEINKESSTKESKILKPNESSVLNFQSLNLTGCTETQQEFLAQEALDCTK
ALLEDEGLADHNLLMALENMPLQHNTSADGCQESEKRRGKRSVEETEMNGQPPLKRRLLE
EFDRSLIDPKASTLHPVKSCSNGLMKDRGVFKYSTSLYPNITRPHRFQKTPQIQNSTMGD
PRSKSAHYKTSAFVPPFVRNAKTETHKNMVLKDSIRTPSAFVPPFKKQRTIVQPTKKTQS
DADGTAVAPAQSDDMNNQSLPVDFRSDSAGGETSGVDGTCSRSQADVYWNLQNTELAQDM
QDMRIRKKKRQNIRPLPGSLYLKKTSGVPRIPLKAAVNGKIPGRYTPKKLYGYGVQKYVS
DITSENAESFRFNLLQFIKREAFTDEGGVQLADGGWLVPSNDGTAGKEEFYRALCDTLGV
DPKLISEAWVYNHYRWIVWKQASMEKSFPEIVGSRCLTPEQVLLQLKYRYDVEVDHSCRP
ALRKIMEKDDTAAKTLVLCVCEIISRGHSPKTQSHNDTKTPHSADAKVETSAALIWLTDG
WYAIKAQLDEPLTAMVHKGRLAVGGKLIIHGAQLVGSQDACSPLEAPESLMLKICANSCR
PARWDAKLGFHKDPRPFLLPISCLYSNGGPVGCVDIVVLRSYPMQWMERKPDGSVVFRSS
RAEEKEARRYNSHKQKAMEILFAKIQSQFENEEKGNIKQQRRRKTISHQEIANLQDGEEL
YEAVGDDPAYLETHLSAQQLEALHTYRCSLMEKKQAELQDRYHRALEAEDNEMNCPKREV
TPVWRLCIADSMELPGRVLVLVYQLNLWRPSSDLHSLLKEGCRFKVYNLTTSDGKKRSSI
EAVQLTGTKKTQFQELQASHEWLSTYFQPRVCTNFVNLQNPDFEPLCGEIDLAGYVITVV
DGKNTGSSPAFYLADEKLNFVKVRCFSSLSQTGLEDVVKPRVILALSNLQLRGQSMHPTP
VVYAGDLTSFSTNPKEVHLQESFSQLKTLVQCQENFFLTAEEKLSELVRSNGLSSSSSPA
LQRQTPASLTDRRQDIKSSKPGRNLGSFTPVGRKSPTPTSSGEKDPKSLKRRRAQDYLSR
IPSPPPLSHLGSVASPCVNKTFNPPRRSVTPSTLKTVQTPSHKPADSLGEDEWVNDEELA
MIDTQALRVNLI
Download sequence
Identical sequences I3JDK0
ENSONIP00000006940 ENSONIP00000006940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]