SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007192 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007192
Domain Number 1 Region: 4-172
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.78e-58
Family G proteins 0.0000000864
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007192   Gene: ENSONIG00000005708   Transcript: ENSONIT00000007197
Sequence length 203
Comment pep:known_by_projection scaffold:Orenil1.0:GL831218.1:1672673:1673740:1 gene:ENSONIG00000005708 transcript:ENSONIT00000007197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMEDYDYLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEIKGEKVKL
QIWDTAGQERFRSITQSYYRSANALILTYDITCEDSFRCLPEWLREIEQYANNQVVTILV
GNKIDLAEKREVLRQRAEDFAEAQSMLYLETSAKESDNVEKLFLDLACELIREAKQNKLD
NSDTAPMPGEGKTISYLSCCNIN
Download sequence
Identical sequences I3JEA1
ENSONIP00000007192 XP_003450202.1.78416 XP_004560589.2.88231 ENSONIP00000007192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]