SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007256 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007256
Domain Number 1 Region: 162-446
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.07e-67
Family Tandem AAA-ATPase domain 0.000000868
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007256   Gene: ENSONIG00000005756   Transcript: ENSONIT00000007261
Sequence length 480
Comment pep:known_by_projection scaffold:Orenil1.0:GL831218.1:2756037:2761871:-1 gene:ENSONIG00000005756 transcript:ENSONIT00000007261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTARTENPVILGLPNQNGQLRGSVKPAGAPGGGGGGPQQLNQMKGTINNGNSQPAPTTN
AVIKPGDDWKKNLKLPPKDMRMKTSDVTATKGNEFEDYCLKRELLMGIFEMGWEKPSPIQ
EESIPIALSGRDILARAKNGTGKSGAYLIPLLERIDLKKDCIQALVIVPTRELALQVSQI
CIQVSKHMGGVKVMATTGGTNLRDDIMRLDETVHVVIATPGRILDLIKKGVAKVGQVQMI
VLDEADKLLSQDFVVMMEEILGFLPKQRQILLYSATFPLSVQKFMNSHLQKPYEINLMEE
LTLKGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFY
IHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLGETYLHRIG
RSGRFGHLGLAINLITYDDRFNLKGIEEQLGTEIKPIPGIIDKSLYVAEYHSESGEEVKP
Download sequence
Identical sequences I3JEG5
XP_003450212.1.78416 ENSONIP00000007256 ENSONIP00000007256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]