SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007367 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007367
Domain Number 1 Region: 7-741
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.07e-256
Family Motor proteins 0.0000000000133
Further Details:      
 
Domain Number 2 Region: 1044-1107
Classification Level Classification E-value
Superfamily SH3-domain 1.08e-22
Family SH3-domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007367   Gene: ENSONIG00000005848   Transcript: ENSONIT00000007372
Sequence length 1108
Comment pep:known_by_projection scaffold:Orenil1.0:GL831150.1:3155668:3205521:-1 gene:ENSONIG00000005848 transcript:ENSONIT00000007372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRGHYRYHWQSHNVKHSGVDDMVLLSKINEDAIVDNLKKRYMDDYIFTYIGPVLISVN
PFKQMPYFGDKEIELYQGAAQYENPPHIYALADNMYRNMMIDRENQCVIISGESGAGKTV
AAKYIMGYISRVSGGGPRVQHVKDIILQSNPLLEAFGNAKTLRNNNSSRFGKYFEIQFSS
GGEPDGGKISNFLLEKSRVVMRNPGERSFHIFYQLIEGATSQQKNSLGITSLDYYSYLNQ
SGSYKVDDINDKSDFQETVKAMDVIGIAPEDRSMVLQIVAGVLHLGNISFKESGNYAAVE
SEEFLAFPAFLLGIDQNRLKEKLTSRKMDSKWGSAVESIDVTLNVEQASYTRDALSKALH
SRVFDFLVESINKAMVKDHQELNVGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELT
LKAEQEEYVQEGIKWTPIEYFNNKIVCDLIESKKNPPGIMSILDDVCATMHAVGEGADQT
MLQKLRVQINTHEHFNSWNQGFIIHHYAGKVSYDAEGFCERNRDVLFTDLIELMQSSEIS
FIRALFPENLNADKKGRPTTAGSKIKKQANDLVSTLMKCTPHYIRCIKPNETKKPRDWEE
SRVKHQVEYLGLKENIRVRRAGYAYRRVFRKFLNRYAILTKESWPTWRGDEKQGVLHLLR
SVNMDQDQFQLGRTKIFVKAPESLFLLEETRERKFDGYARTIQKAWRKYVARKKYVQMRE
EASDLLLNRKERRRHSLNRNFVGDYLGMDDRPELRQFLGKREKIDFADKVTKYDRRFKAI
KRDLILTPKSVYLIGREKVKQGPEKGQVTEVVKRRIDVDKILAVSLSTMQDDFLILHEQE
YDSLLECTFKTEFISLLAQRFEEKTQRKLPLKFSNTLEMKLKKENWGFLSGGGSRQVTFV
QGQGDMPVLKPSSKSLQVSIGPGLPKNTRPTRKSFTQSRSNMSRSHQHTPSRAAPGPPVS
HQNGGIRNTNHVTNQRNSQHHSKRHPSSHNSAHPVLPSNINQVKERGGSRQQPNLDCLRV
PDQGAAGAHRPSASRPPPGGGRPKPAPKPKPQVPQCKALYAYDAQDTDELSFNADDMIDI
IKEDASGWWTGRLRGKQGLFPNNYVAKI
Download sequence
Identical sequences I3JES6
ENSONIP00000007367 ENSONIP00000007367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]