SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007488 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007488
Domain Number 1 Region: 101-167
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000162
Family RING finger domain, C3HC4 0.03
Further Details:      
 
Domain Number 2 Region: 284-350
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000742
Family RING finger domain, C3HC4 0.021
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000007488
Domain Number - Region: 168-224
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0194
Family Motor proteins 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007488   Gene: ENSONIG00000005948   Transcript: ENSONIT00000007493
Sequence length 352
Comment pep:known_by_projection scaffold:Orenil1.0:GL831138.1:1761425:1769809:1 gene:ENSONIG00000005948 transcript:ENSONIT00000007493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRKNLKSNASSKLVITSAAFQDHIMRSLLHPDFSLSDPLRRRSRGKHPQVREGVEERD
LQRRHEQEEREYVLGPAPPPLTLAQKLGLVASPRERLTEDEWTRVKGRSIQQEESAQPCA
ICREEFRLQPQVLLSCSHVFHRACLQAFERFSGRKRCPLCRREPYETRVINDAARLFRHR
CATRIQAYWRGYKARKWYRTIKKSICPKDKRLRRQFFESRLQELNDSFVRYCHTDTEAFL
SDIDRSLSSSRRVFQQLERKSVSEPQENDWDRIKSQVIQRGVWDCPICLTALSNLSLPTV
SERSNHQQRRPTVLLSCSHLFHQLCLEAFEAFSADSRPLCPLCRSAYHKKLI
Download sequence
Identical sequences I3JF47
XP_005448982.1.78416 ENSONIP00000007488 ENSONIP00000007488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]