SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007693 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007693
Domain Number 1 Region: 708-850
Classification Level Classification E-value
Superfamily Bromodomain 2.22e-24
Family Bromodomain 0.0008
Further Details:      
 
Domain Number 2 Region: 644-697
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000391
Family PHD domain 0.0017
Further Details:      
 
Domain Number 3 Region: 58-117
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000298
Family B-box zinc-binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007693   Gene: ENSONIG00000006104   Transcript: ENSONIT00000007698
Sequence length 892
Comment pep:known_by_projection scaffold:Orenil1.0:GL831150.1:4922141:4933423:1 gene:ENSONIG00000006104 transcript:ENSONIT00000007698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSCSECTEPTLAQSLCTLCNKWLCYQCTDVHQHLRTPNTSQYMESHQQQRPSASPGSYPW
SLLMCHSHRQEPLELFCESCDLLCCSSCHLSSHKNHRVVQIGKALQDQQWLFESLMVQVE
EKRSAVENSAKQIEERLHGVKITHRKAENQIKMAKMIMMNELNKRANLLIEQLEKIAEGF
QQRLEDQLQGAIEICGQLDHIQKFITWAMTHHCTSPVLFSRALISLQMQQLLEASHHSDS
WSPVKIKFNWDASYWTKQISCLGQLTVEGGNCAYPPGLACSSIMRPQPITCLTLPPVFHR
GREPGCGYQACCEPQMCCLHGIHSQPDLPSLDKSQLDTTLYNSSCAQPAHISASQHQNQQ
IQRFWDQESSLQRPPPASPVPNRRHNQLSRSRASASQPQAADSQPHSQSYLSHHQHRKDV
LPNTQARLSAERGRPSRRRGKLSTSRSLQQELHNRPSLKILKMGDYYHKDLDQFLDHPIT
YADSDPQLDSDASPDSDPNAPSSSEAELECLAEQKSGEMGLCGDSEPSLEYEADPESDAG
PDGRGLDADTESGDAETESDIQPEYDPTFHGETDSDVVSDQPPESQGSVASELNVDSEPE
LTTDDPQPLRSDLDEEISPGQRPLLIANPVAPGDTEEVLTEQDGTELESEDFCAVCLIGG
DLLCCDRCPKVFHLSCHIPPLPTFPSGDWVCTLCRDVLQPDVEYNGDNERASGENASANV
LSPCDQKKCERLTLLILSNILSAPFQEPVSPLARHYYQIIKRPMDLSVIRAKLSKGNTQC
YSSPDEFVADMYLMFHNCAKFNYYIRFISLDIDTAPPSLQPDSEVAQAGRSLEAFFTSNL
KEVFPGRVFPMAEVDSDSDEYDEAYRTTESGFPWPERREQCHRKRKRRQSLK
Download sequence
Identical sequences I3JFQ2
ENSONIP00000007693 ENSONIP00000007693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]