SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007715 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007715
Domain Number 1 Region: 14-184
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.29e-52
Family G proteins 0.0000000628
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007715   Gene: ENSONIG00000006123   Transcript: ENSONIT00000007720
Sequence length 204
Comment pep:known_by_projection scaffold:Orenil1.0:GL831150.1:5205691:5231774:-1 gene:ENSONIG00000006123 transcript:ENSONIT00000007720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSMAGWKDGSVQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDER
PARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEF
PMILVGNKADLELQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQE
QECPPSPEPTRKEKDKTGCHCVIV
Download sequence
Identical sequences I3JFS4
ENSONIP00000007715 ENSONIP00000007715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]