SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007753 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007753
Domain Number 1 Region: 98-210
Classification Level Classification E-value
Superfamily TPR-like 1.22e-27
Family Tetratricopeptide repeat (TPR) 0.0029
Further Details:      
 
Domain Number 2 Region: 248-270,303-386,426-697
Classification Level Classification E-value
Superfamily ARM repeat 1.15e-23
Family Armadillo repeat 0.065
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000007753
Domain Number - Region: 44-72
Classification Level Classification E-value
Superfamily SOCS box-like 0.0915
Family SOCS box-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007753   Gene: ENSONIG00000006155   Transcript: ENSONIT00000007758
Sequence length 701
Comment pep:known_by_projection scaffold:Orenil1.0:GL831228.1:1835125:1854372:1 gene:ENSONIG00000006155 transcript:ENSONIT00000007758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTMEKFEDVESFLKSVDEISQLVEDLRSSDAEAQQKAMEKADCYITSLTEPCRTKINKTT
INTNPPPLPPSIVSLGSENFIKIMEMDAEERRVRKAANVKKAIAFKDKGNEAYAQEDYET
AIKYYSDGLAEIKDMQPLYTNRAQAYIKLGKYNEAISDCEWALKCNERCIKAYLHMGKAY
LGLMKYNEARGCFEKIQEIQPGKEKIVKEYLTQVDLEKEKETQEIKAKEEFDKGERKATT
VVELLEKLSKPGQIALYYCGGLEILSQALTDCTGQTLFRLNNGFSIITSNVTVRSCLLEK
TNDPESRELCVSVLKLWRRVCCGNDENQKLLMTCPVATQSIVHLASSEHDEVAKECLALL
SVYSEIPRGRHLAIESLDLNMLVRNLMVCVSKPKKQQENTAVSILQNFATESRFCIQLRN
VLTDSVILPVTTILKNVNTSNQHILPSLISGLGCLARDDVIRHKLAHDPECCGGFYSLST
QRTCIASEYREILYPLLGLIMNLSTVTSPVVQELSVSLCDSCVDLLRHNDEGIITRATGV
LSAVLPQSPQAVQHVIQREMVKTMCRLLEGTGQTATKYAIKTLTVCTAASHLAREKLVNS
DKKLSILRCLLSSSCDEMVSGNAALCLAHCLDLEGVASDLLGTDIVLLLLRHAAGDAKRT
AVQQNAAIALGKLCRCEPRHTSKLRELHGLEILHSCVKLIS
Download sequence
Identical sequences I3JFW2
ENSONIP00000007753 ENSONIP00000007753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]