SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007766 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007766
Domain Number 1 Region: 3-261
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.99e-75
Family G proteins 0.0000000565
Further Details:      
 
Domain Number 2 Region: 337-441
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 3.52e-41
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0000052
Further Details:      
 
Domain Number 3 Region: 238-334
Classification Level Classification E-value
Superfamily Translation proteins 4.86e-26
Family Elongation factors 0.0000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007766   Gene: ENSONIG00000006165   Transcript: ENSONIT00000007771
Sequence length 456
Comment pep:known_by_projection scaffold:Orenil1.0:GL831138.1:3584101:3590062:1 gene:ENSONIG00000006165 transcript:ENSONIT00000007771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGREKTHVNVVIIGHVDSGKSTTTGHLVYKCGGIDQRRLEKFEKAANEMGKSSFKFAWVL
DKLKAERERGITIDITLLKFNTQKYIMTVIDAPGHRDFIKNMITGTSQADVALLVVSAAK
GEYEAGVSRSGQTREHALLAYTLGVKQIIVCVNKMDLTEPPYSQSRFEEVMRGVSGFLRK
IGYDTTAVPFVPVSGWTGENMITASQRMPWFQGWKVRRREGNKSGRTLLEVLDSIQPPVR
TVNKPLRLPLQDVYKIGGVGTVPVGKIETGVLKPGMMLTFSPAKLTAEVKSIEMHHQGLE
TALPGHNVGFNIKNVSVKNLRRGDVAGNAQQDPPSDVKSFDAQVIILNHPGKIKAGYSPV
LDCHTAHVTCRFAELKEKLDRRTGKKLEDNPQIVMSGDAATVKLVPIKPMCVESFFTYPP
LGRFAARDLKQTVAVGVIKSVEKNHGSKPHKAQVCK
Download sequence
Identical sequences I3JFX5
XP_019218605.1.78416 ENSONIP00000007766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]