SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007806 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007806
Domain Number 1 Region: 150-347
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.03e-44
Family G proteins 0.0000502
Further Details:      
 
Domain Number 2 Region: 14-147
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 3.66e-24
Family Obg GTP-binding protein N-terminal domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007806   Gene: ENSONIG00000006196   Transcript: ENSONIT00000007811
Sequence length 368
Comment pep:known_by_projection scaffold:Orenil1.0:GL831229.1:1249911:1252979:-1 gene:ENSONIG00000006196 transcript:ENSONIT00000007811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHITRICLRKYGNFVDNLRLYVRGGSGGMGLPRLGGQGGNGGDVWVVAKKNMTLKRIKD
KFPQKRFVADAGANSGVRALKGERGADKEILAPVGITVTTDEGRTFGDLNVEGDRVMVAK
GGSGGSLYSAFQPSKGEAKHIRLDLKLIADMGLVGFPNAGKSSLLTALSNATPQIASYAF
TTLKPEIGKLIYDDYKQISVADLPGLIEGAHMNKGMGHKFLKHVERTKQLLFVVDVCGFQ
LASKTPFRSAFEAVQLLTKELELYKEELLSKPALLVVNKMDLPDAEDKLAELKEQLQNPE
EFSDLLPEDMIPQNYLTFRHVVPVSAITGFGISHLKSCIRQSLDEDAALEVKATHREKLQ
ALRKQLQG
Download sequence
Identical sequences I3JG15
ENSONIP00000007806 ENSONIP00000007806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]