SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000008483 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000008483
Domain Number 1 Region: 35-217
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.68e-56
Family G proteins 0.000000832
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000008483   Gene: ENSONIG00000006715   Transcript: ENSONIT00000008488
Sequence length 234
Comment pep:known_by_projection scaffold:Orenil1.0:GL831237.1:907206:910136:-1 gene:ENSONIG00000006715 transcript:ENSONIT00000008488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIENKPGEEFDTIFSRNDSLELSSHHEYDTTHARIFKIIVIGDSNVGKTCLTYRFCGGT
FLKNPEATIGVDFRERTLELDGESIKLQIWDTAGQERFRKSMVEHYYRSVHAVIFVYDVT
SLSSFESIPEWIQECSRHSVGPLVPRIMVGNKCDLRDRREVPTSAAQCLADSYNFPLFET
SAKDPSEKENVDAIFLTLAYRLKSHKPLRLKQPSESNLRQMWNQREREAATCQC
Download sequence
Identical sequences I3JHY9
ENSONIP00000008483 XP_003451619.1.78416 XP_004568076.1.88231 XP_005733890.1.53837 XP_005935172.1.24487 ENSONIP00000008483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]