SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000008572 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000008572
Domain Number 1 Region: 1-280
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.5e-94
Family Motor proteins 0.000000084
Further Details:      
 
Domain Number 2 Region: 339-443
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.93e-23
Family FHA domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000008572   Gene: ENSONIG00000006792   Transcript: ENSONIT00000008577
Sequence length 1086
Comment pep:known_by_projection scaffold:Orenil1.0:GL831344.1:656116:667336:1 gene:ENSONIG00000006792 transcript:ENSONIT00000008577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMGAPGDAGLIPRICEGLFSRISEATRWDEASFRTEVSYLEIYNERVRDLLRRKSTQTYN
LRVREHPKGGPYVEDLSKHLVQNYGDVEELMEAGNINRTTASTGMNDVSSRSHAIFTINF
TQAKFDAEMPSETLSKIHLVDLAGSERADATGATGVRLKEGGNINKSLVTLGNVISALAD
MSQGGVNTNLKKKSVFVPYRDSVLTWLLKDSLGGNSKTIMIATISPADVNYGETLSTLRY
ANRAKNIINKPTINEDANVRLIRELRAEIARLKALLVQGNQIALLDSPTALSMEEKLHQN
EARVLELTKEWTNKWNETQNILKEETLALRKEGIGVVLDSELPHLIGIDDDLLSTGIILY
HLKEGRTYVGREDASTEQDIILHGLDLESEHCMFENQNGTVTLVPLAGAQCSVNGVQVME
PSQLNQGAVILLGRTNMFRFNHPKEAAKLREKRKSGLLSTFSLSMTDLSKSCENLSTVML
YNPGLEFERQQREELEKLEMKRRLIKEMEAKQQSEKAELERLQQEVESQRKESEEVQQRI
LRQEESLHRRSQDIESRLRDFLAEKERFEEERRSEINEVDLQRRRRRKEPQEREADRAEE
RDEQQRRHQEAAEQTEIYRELERLKREREEQRVRLETERRRLEEQEREQLNLVGRLEEQE
REQLNLVGRLEEQLREKHEAATALLTREDARRLEEEQRALAEIREALLRAKEAAERPDVE
DAGEEARAAQSRYADFKVAQVKELGLLEEGLRQQRERLEKEVAAERGALLLLTHSLRERQ
QHLKDTQEKGAQDATAVCHEEQLLRQAEHRLQLKERQLANLADGLLPALAEEKQRASELL
ERSGNGNCDRPPGLDNTLFQVEKELEDKEEKLSLHWHSARQLQQLQETYEFTANVARQEE
KVRRKEKEILESKEKQQREAMEQAVARLERRHSALRRSVSLEPDSEEQRSKSSVARTPRT
GAELDQQRVQREIQKLRQRISEGDDTSRTHSISSDERAGQTHIQGLNTLLPLSDDRINAY
IEEEVQRRLRKMNLLNGSSMDLSLSTESLREEEEEEVSDCSSVRLTDEVRPGSSSLHSHH
QTFPAL
Download sequence
Identical sequences I3JI78
ENSONIP00000008572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]