SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000008676 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000008676
Domain Number 1 Region: 5-167
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.34e-57
Family G proteins 0.0000000792
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000008676   Gene: ENSONIG00000006876   Transcript: ENSONIT00000008681
Sequence length 194
Comment pep:known_by_projection scaffold:Orenil1.0:GL831330.1:1062452:1072348:1 gene:ENSONIG00000006876 transcript:ENSONIT00000008681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWD
TAGQERFRALAPMYYRGSAAAIIVYDITKEDSFQTLKNWVKELRQHGPPNIVVAIAGNKC
DLSDAREVPEKDAKDYADSIHAIFVETSAKNAININEVFVEISKRIPVVDEAGGSSARGF
KLGRQASESRRTCC
Download sequence
Identical sequences I3JII2
XP_003456145.1.78416 XP_004547669.1.88231 ENSONIP00000008676 ENSONIP00000008676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]