SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000008815 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000008815
Domain Number 1 Region: 2-166
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.16e-43
Family G proteins 0.0000036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000008815   Gene: ENSONIG00000006991   Transcript: ENSONIT00000008820
Sequence length 184
Comment pep:known_by_projection scaffold:Orenil1.0:GL831254.1:467226:476224:1 gene:ENSONIG00000006991 transcript:ENSONIT00000008820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKHIKCVVVGDYEAGKTCLLNSYTNENLPFKDFPMSFATCVRTVMIDDEEYSLQLCDTSG
QEDYERIRLNTYTGTDVFLVCFSVVSPSTFRNVREKWVPEILRFSPRMPFLLVGTHVDLR
DNENTLEQALTFKSGEELAHQLKAVKYMECSAQTREGVKEVFEEAILATLNPTDKKSTYI
CVLL
Download sequence
Identical sequences I3JIX1
ENSONIP00000008815 ENSONIP00000008815 XP_005457581.1.78416 XP_005457582.1.78416 XP_013131538.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]