SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000008822 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000008822
Domain Number 1 Region: 1-176
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.07e-44
Family G proteins 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000008822   Gene: ENSONIG00000006996   Transcript: ENSONIT00000008827
Sequence length 230
Comment pep:known_by_projection scaffold:Orenil1.0:GL831276.1:1899243:1915145:-1 gene:ENSONIG00000006996 transcript:ENSONIT00000008827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRERLLKVLVIGDLGVGKTSIIKRYVHQVFSQHYRATIGVDFALKVLNWDHKTVVRLQL
WDIAGQERYGNMTRVYYREAVGALVVFDMTRLSTFQAILKWKGDLDSKVALSNGRPVPAV
LLANKCDQRRHGLCPKLPKLENFSKEYGFVDWYETSAKDNTNIDAAITCLVKSIMSVEEE
RALGEATSGADKGDPDGSVLVLPRFDYNTTEKGLGGCAGCLSIKPKQDQD
Download sequence
Identical sequences I3JIX8
XP_003453996.1.78416 ENSONIP00000008822 ENSONIP00000008822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]