SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000008824 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000008824
Domain Number 1 Region: 967-1094,1126-1331
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.85e-75
Family p120GAP domain-like 0.00015
Further Details:      
 
Domain Number 2 Region: 34-198
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.83e-38
Family Calponin-homology domain, CH-domain 0.0000216
Further Details:      
 
Domain Number 3 Region: 1556-1653
Classification Level Classification E-value
Superfamily RGC domain-like 7.59e-33
Family RGC domain 0.00000556
Further Details:      
 
Domain Number 4 Region: 628-830
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000451
Family Motor proteins 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000008824   Gene: ENSONIG00000006998   Transcript: ENSONIT00000008829
Sequence length 1653
Comment pep:known_by_projection scaffold:Orenil1.0:GL831358.1:631859:673558:-1 gene:ENSONIG00000006998 transcript:ENSONIT00000008829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTSEEGDGPRPRYGSVLDGVERLTAEEMDERRQQNMAYEYLCHLEEAKRWMEACLDEEL
PPTTELEEGLRNGVYLAKLGNFFAPQTVSLKKIYDREQTRYKATGLHFRHTDNVIQWLNA
MAEKGLPKIFYPETTDIYDRKNMPRCIYCIHALSLYLFKLGLAPQIQDLYGKVDFTEEEI
NNMKSELEKYGIQMPAFSKIGGILANELSVDEAALHAAVIAINEAIDQGVPEGTLAAMQN
PNAMLVNLDRSCAQQYHDTLYQAKGKKVANSRKRQMENAEAERDIYDELLTQAEIQGNVN
KVNVNNALSEAEQALLSGDEDKLYEALKAMGIQNLQPQNKAWYLKQLQGDRENKEQTSPG
EALTKDELQSGVDVANGIAESYLKMLKAVERINNAIREGVPEKTVEELMNPDAQLPEVYP
SAADLYQRELASLQQQSQEGNLTHPELLVAVEMLSSVVLMNEALDVRDRAALWKQLSSTV
TGLSNVEDEYAQRYMDELMRLKAAAREEGSDYLTWNDIQACIDQVNLAVQEEHERIAAIG
LINEALDEGDPTKTLSMLQSPSAKLTDVDPSIAQHYHDKLLEARREKAHETQDPSAVLWL
DEIQDAILKANQDTKEALQFSQAIQAVNEAVDSGDAAQTLAALRSPGAGLYGVTSECAQT
YQDDLAKIKQEKKKEGDNGSEWVKHWVKGGHNYYYNLQTKEGTWVEPENFIQNNTQLNKE
DIQGVVSGVTTAYNREQLWLANETLITKLQARCRGYLVRKGQKERMEFLKSQDPAVTCIQ
AHWKGYKQRKAFKDRKEYLKDHTAEAVKIQSMVRMHQARKKYKDRLKYFEDHIDDVVKIQ
AFIRANKARDDYKTLISADNPPMGVVRKFVHLLDHSDQDFQEELELMRLREEVVTNIRSN
QQLENDLNLMDIKIGLLVKNKITLQEVVSHSKKLTKKNKGQLSDMMMMTKQKGGLKALSK
EKRLKLEAYQYLFYLLQTNPTYLAKLIFQMPQNKSTKFMDSVIFTLYNYASNQREEYLLL
KLFKTALQEEIKSKVDQMKEIVTGNPTVIKMVVSFHRGARGQNALRQILAPVVKEIMDDK
TLNIKTDPVDIYKGWVNQMESQTGEASKLPYDVTPEQAMSHEEVRTRLEASIKNMKTITD
KFLSAIIVSVEKIPYGMRFISKVLKDTLHEKFPDATEDELLKIVGNLLYYRYMNPAIVAP
DAFDIIEMSAGGQLTTEQRRNLGSVAKMLQHAASNKMFLGDNAHLNPINEYLSTSYQKFR
RFFLAACDVPSLEDKFNVDQYSDLVTVTKPVIYISIGEIINTHTLLLDHQDAIAPEHNDS
IHELLEDLGEVPTVESLIGENPLPADDPNKELMGKTEVSLTLTNKFDVPGEANAEMDAKT
LLLNTKRLIVDVIRFQPGETLTEILDSTASPEQEAEYQRAMQRRAIRDANTPEKMKQVKP
VVDDSLTLQGKKDKIKSNLQRLAELGKVHPENRYQDLINDIAKDIRNQRRYRQRRKAELV
KLQQTNAALNSKTNFYNVQIDSYNQYIKTCMDNLASKGKLSKKPGDNKAKKSKQVSQKYT
AARLHEKGVLISIEDLQPNQFKNAIFEISPSETVGVFDVKAKFMGVHLETLQLEYQDLLQ
LQYEGVAVMKLFDRATINVNLLIFLLNKKFYGK
Download sequence
Identical sequences I3JIY0
XP_003456940.1.78416 ENSONIP00000008824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]