SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000009009 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000009009
Domain Number 1 Region: 2790-2912,2946-3067
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.56e-27
Family Nitrogenase iron protein-like 0.093
Further Details:      
 
Domain Number 2 Region: 1828-2040
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.49e-23
Family Extended AAA-ATPase domain 0.034
Further Details:      
 
Domain Number 3 Region: 2450-2715
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.41e-17
Family ABC transporter ATPase domain-like 0.057
Further Details:      
 
Domain Number 4 Region: 2058-2262
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000506
Family RecA protein-like (ATPase-domain) 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000009009   Gene: ENSONIG00000007143   Transcript: ENSONIT00000009014
Sequence length 4318
Comment pep:known_by_projection scaffold:Orenil1.0:GL831158.1:1842796:1918035:-1 gene:ENSONIG00000007143 transcript:ENSONIT00000009014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSKVFVTDGRDVALTGVCVFFTRANTSKAVTSENIHRDVNFNMLDTTEGGLLKSVEQLLS
EIFIPTLRKMNHGWGEGTSPQTLAVKQDFISSLESFVSVLAGAQESLQEKVTLKECDTFD
LRVLKGPSDYVAAASSTETIEKIEACMKVWIKQIEQVLAESDQLRKEADDLGPRAELEHW
KKRMTRFNYLLDQLKSPDVKAALGVLLLAKSKLIKSWRELDARITDGVNEAKDNVKYLYS
LEKFCDPLYNSDPVSMVDAIPGLINAIRMIHSISRYYNTSEKITSLFVKVTNQMITACKA
YITNNGANSIWDQPQQVITEKIKAAIRLNQEYQRCFHRTKEKLEQTPSERQFDFSEMYIF
GKFDTFQRRLNKILEMFATISTYSVLKDSKIEGLETMATRFQAIVLNMKKKHYSFLDQRK
SDFDVDYEEFCKSTSELHNQLKSFMDSTFEKIQNTERALNVLKTFQRLGIPDLGIDEKYQ
QILQNYGRDIEMVSRIYMKQKLDPPIGRDLPPVAGRIMWARQLYSRIQEPMDLFQQHPGV
LSTSEAKRIIKNFNRVARVLLEFEMIYHHSWMKKMEDAKAGLQASLLVRSPETGELFVNF
DPEILTQIREVNCMTRMNLAIPPFAFLLLQKQDILKKHYNRIQLMLSENTRVRAKIQSVF
EQLAMPHVAKVDEAIQPGLTSLSWTSLNIDKFLDRIDKALADLELLMDRVNDLVEFRIEA
VLQEMSISTLCVLPEDEPVTCEEFVQTTRDLCIRQAQKVNMKSSLVEEAANELINMLLEF
DHNQREEVEKFEEESCTESKTIDHNDSEGILVRRKKKRDLMEVMEQEAQELLSYFNHRNV
DALLRVTRNTLEMLRKRIHMSSLINFSAASDPTSHGKSSGHHAIFRVNMTLSIPNIVMVP
ALEEVQQALNRAVECVVSVSKGVSQWSKERISKFKTCCFQHTITKIIYTERDKLNGNMSA
SVIQAIPFQARNYYKSVSENKEIAKLISVLSSSITSSKKEVVTALHHFSCYHHIWRKDRE
ETMRKFIEGSPLLSEFESQILFYRDLELEVNSEPEYIAVGALALFTAPLKMSLSAEIKNW
MVDYGLYCNRKCRSEMEHIFAFVDEAGKKLNRQIKDLDDIRIAMAALKEIREHQISIDFQ
VAPIEESYAMLHKYELSVAKEEAEKVDTLRYTWEKLLSRSTEVQNELVALQPNFREELVS
NVETFLEDCQHFYQDYEKLKDGPMVVGLAPQDASDRLIMFQNRFDNLFRKYITYTGGEEL
FGLPVTQHPQLLEIRKQLALLQKLYGLYNNVIDTVNGYYDILWADICIEKINNELLDFQT
RCRKLPRALKEWQAFQDLKKTIDEFSECCPLLELMTNKAMMARHWKRITEVTGHTFEVET
DTFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLKQVIAEWDNKTFTFASFKTRGEL
LLRGDSTSEIIASMEDSLMILGSLMSNRYNTPFKGQIQKWVQNLSNTTDIIEHWMTVQNL
WIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMMRAHEMPNVVQSCVGDETMGQLLPH
LLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKC
VQFHEKIYDRILAVSSREGETVELDRPVTAEGNVEVWLNALLKESQRSLHLVIRQAALAI
QDSGFQLIDFLNSFPAQVGLLGIQMIWTRDSEEALTNARYDRRIMSKTNQFFLDLLNTLI
DMTTRDLEAVERTKYETLITIHVHQRDIFDELCRLHVKSSSDFEWLKQCRFYFNEDSDKM
IINITDVGFVYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETIK
DMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAI
VLTCKKERRKNFIFTDGDNVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVAMMVPDR
QIIIRVKLASCGFIDNMELARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRA
NPSDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPGIQLDKAGYPELEAAIDKQVE
DAGLINHSPWKLKVIQLYETQRVRHGMMALGPSGAGKTTCIHTLMKAMTECGHSHREMRM
NPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHIWIVLDGPVDAIWIENLNS
VLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLTWIPILEG
WLKKRSPHEAEILRKLFSSSFSELYRFCVQSLEFKMDMLEAFVIMQCINMLQGLIPLKEQ
CGDLSREFLERLYVFALMWSAGAVLELDDRRKMEIWLRGNKSIHLNLPDIPPDSEDTMFD
YYVTADGHWVHWNTRVEEYIYPSEFTPEYSSILVPNVDNVRTDFLIQTIAKQGKAVLLIG
EQGTAKTVIIKSYMSKYDPETHIGKSLNFSSATTPLMFQRSVESYVDKRMGTTYGPPAGK
KMSIFIDDINMPVINEWGDQVTNEIVRQLMEQNGFFNLEKPGEFTNIVDVQFLAAMIHPG
GGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGEGHFCTGRGFSEEVQSTVPRLVSLT
RRLWQLTKVKMLPTPAKFHYIFNLRDLSRIWQGMLSTNAEVVTSVQMLMALWKHECKRVI
ADRFTMPGDVEWFDQALAKLVEEHLGEEHKKMVDYGAERYFVDFLRDAPEATGEEPEDSD
FDLPKVYEPIESFEALKDRLNMFLSHYNESIRGTGMDMVFFQDAMIHLVKVSRIIRTPGG
NALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRSYNTSNLMDDLKSLYRTAGQHGKGIS
FIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDDILNDLIPVMKREFPRRPPTNGNL
YDYFMSRVRHNLHVILCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVRVSEHFL
SVYDIDCSPQVKCEVVQCMGSFQDGVAEKCADYFQRYRRSTHVTPKSYLSFIQGYKTIYK
EKRSEVQTLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANDKADMVLKEVTVKAQ
AAERVKVEVQKVKDKAQAIVDSISADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVR
TLGRPPHLIMRIMDCVLLLFQRKVNPVKIDPEKNCNTPSWQESLKLMTAGNFLGSLQQFP
KDSINRETVELLQPYFEMPDYNIETAKRVCGNVAGLASWTKAMASFFSINKEVLPLKANL
AVQENRLTIANADLQKAQAELDAKQAELDVVQAEYEKAMMEKQTLLEDAERCRHKMQTAS
SLISGLAGEKERWTEQSKEFAVQTKRLVGDVLLATAFLSYSGPFNQEFRNLLLNDWQREL
KQRCIPFGNNLNLTELLIDAPTVSEWNLQGLPNDDLSIHNGIIVTKAARFPLLIDPQTQG
KIWIKNKEAKNELQITSLNHKYFKNHLEDSLSLGRPLLIEDVGEELDPALDNILEKNFIK
TGSTYKVKLGDKEVDVMKGFRLYMTTKLPNPAYTPEISARTSIIDFTVTMRGLEDQLLGR
VILTEKQELEKERTDLLEDVTSNKRKMKELEDSLLYRLTSTQGSLVDDESLILVLSNTKC
TAEEVTQKLQIAAETEIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGL
FDLSLARSSKSPITSKRIANIIEFMTFEVYKYAARGLYEDHKFLFTLLMTLKIDMQSNKV
KHEEFLTLIKGGASLDLKACPQKPAKWILDMTWLNLVELSKLWQFADILDQISRNEKQWK
AWFDKEAPEEEVVPNSYDQSLDCFRRLLLIRCWCPDRTIAQARKYIMDAVGEKYTEGVIL
DLEKMWEESDPRTPLICFLSMGSDPTDSIIALGKKLKIETRYVSMGQGQEVHARKLLQQT
MANGGWALLQNCHLGLDFMDELMDTVTETDFVNDSFRLWMTTEVHRHFPITLLQMSIKFT
NEPPQGLKAGLKRTYGGINQDLLDVSNMAQWRPMLYAVAFLHSTVQERRKYGPLGWNIPY
EFNQADFNATVQFVQNHLDDMDIKKGVSWNTVRYMIGEIQYGGRVTDDYDKRLLNTFAKV
WFSEEMFGPAFSFYKGYSIPKCSSVDQYLTYIQGLPAYDTPEVFGLHPNADITFQSKLAK
DVLDTILSIQPKDSSSGGGETREAVVSRLADDMLEKLPPDYVPFEVRERLQKMGPFQPMN
IFLRQEVDRMQRIIVLVRNTLTDLKLAIDGTIIMSENLRDALDCMYDARIPARWKKVS
Download sequence
Identical sequences I3JJG5
ENSONIP00000009009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]