SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000009144 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000009144
Domain Number 1 Region: 743-907
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-43
Family SPRY domain 0.0004
Further Details:      
 
Domain Number 2 Region: 526-763
Classification Level Classification E-value
Superfamily RNI-like 8.97e-36
Family 28-residue LRR 0.00044
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000009144
Domain Number - Region: 89-270
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00425
Family Extended AAA-ATPase domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000009144   Gene: ENSONIG00000007251   Transcript: ENSONIT00000009149
Sequence length 915
Comment pep:known scaffold:Orenil1.0:GL831279.1:777116:783955:-1 gene:ENSONIG00000007251 transcript:ENSONIT00000009149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCYVTASDTGVGASICQDKLKSNLRKKFQHLFEGITKAGNPAPLNQIYTELYITEGGTGE
VSDEHEVRQIETASRRHARLEKTITCKDIFQPLVGRDEPVRTVLTKGVAGIGKTILTQKF
TLDWAEGKNNQDIQFTFPFTFRELNGLKEEKVSLVELVHLFFSETKDAEFCRFEDFQVVF
IFDGLDECRLPLDFQKNKILTDVTESTSVDALLTNLIRGKLLPSARLWITTRPATASHID
PKCVDVITEIRGFTDSKKEEYFRKSFRDEEQASRIISHIKASQSLHIMCHIPVFCWITAT
VLEDVLKTKKGGELPKNLTELYIHFLVVQAKVKKVKYDGGAETDPHWSPESRKMIESLGK
LAFDQLQKGNLIFYESDLTECGIDIRAASVYSGVFTQIFKEERGLYQDKVFCFVHLSVQE
FLAALHVHLTFINSGINLLEEEQTTTQMSKPNQYELKLFYQSAVEQALQSPNGYLDLFLR
FLLGLSLQSNQTLLQGLLKETGVNSQINQEVAKYIRENIGENLSPERSINLFHCLNELND
HSLVEKIQQSLTSGNLFTVKLSPAQWSALVFILLSSEKDLDEFDLRKYSASEEGLMWLLP
VVKASSKSLLGGCSLSNESCEALASVLSCQSFSMIELDLNNNDLQDSGVELLSRGLKSPQ
CKLETLSLSGCLITEKGCASLSSALSSNPSHLRKLDLSYNHPGPTGMTLFSAALQDPLCR
LDSLSLENCGAQRLTGCLPSDACELKMDPNTVHRNLYLSENNIVTDDDEEWLYPNHSDRF
ECWYQLMCTSGLTGRCYWEVDWSGLVSIGVTYRGIKRSGCGIDSRIGGNNISWSLDCSAD
NYSAWHNNSVRITDSPAPSTETNTVGVYLDWSAGTVSFYRIVFDTPKHIHTFHCSFTEPL
YPIFRIRSEFTYGVY
Download sequence
Identical sequences I3JJV0
ENSONIP00000009144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]