SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000009338 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000009338
Domain Number 1 Region: 503-817
Classification Level Classification E-value
Superfamily RNI-like 2.92e-54
Family 28-residue LRR 0.00011
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000009338
Domain Number - Region: 75-248
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0664
Family Nucleotide and nucleoside kinases 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000009338   Gene: ENSONIG00000007406   Transcript: ENSONIT00000009343
Sequence length 817
Comment pep:novel scaffold:Orenil1.0:GL831732.1:26837:37679:1 gene:ENSONIG00000007406 transcript:ENSONIT00000009343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKNEFECVFEGIAKAGNPTLLNEIYTELYITEGGTAEVNDEHEVRQIETASRKPDRPETT
ITQEDIFKASPGRDEPIRTVLTKGVAGIGKTILTQKYTLDWAEDKANQDIQFIFPFTFRE
LNVLKEENFSLVELVHHFFTETKEAGICSFEDFQVVFIFDGLDECRLPLDFHKTTILTDP
RKSTALDVLLINLIRGKLLPSAHLWITTRPAAANQIPPKCVGRVTEIRGFTDPQKEEYFY
KRFRDEEQASRIISQIKTSRSLHIMCHIPVFCWITATVLEDVLETREGGQLPKTLTEMYI
HFLVVQAKVKKVKYDGGAETDPHWSPESRKMIESLGKLAFDQLQKENLIFYESDLTECGI
DIRAASVYSGVFTQIFKEERGLYQDKVFCFIHLSVQEFLAALYVHLTFIKSGVNLLEEQT
TSMWSTSSDKPKLQSLHQSAVNKALQSPNGHLDLFLRFLLGLSLQTNQTLLRGLLTQTGS
SSQIHQETVQYIKNRLSWTLSAEKSINLIHCLNELNDRSLVEEIQQYRSSGSLSTGKLSP
AQCSALTFMLLSSEEDLDEFDFKKYSSSEEALLRMLPVVKASRKVLLSSCNVSEEGCENL
LSVVSSQSCSVRELDLSTNSLKASAVKLLSAAVESPHTKLNILRLNICELSEEICEALSS
VLSSQSSSLTELDLSIRKLQGSGVKLLSAGLQSLNCKLNTLRLSGCNLSERSCLALSSVL
SSQSSSLRVLDLSNSDLQDSGVKLLSAGLKGSQCAVETLSLSGCLITEEGCTSLASALSS
NPSHLRELDLSYNHPGDSGMKPLSAGLKDPGWRLDTL
Download sequence
Identical sequences I3JKE4
ENSONIP00000009338 ENSONIP00000009338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]